Lamin A + C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85550

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Zebrafish

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Lamin A + C Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRE

Reactivity Notes

Zebrafish reactivity reported from a verified customer review.

Marker

Nuclear Envelope Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Lamin A + C Antibody - BSA Free

Western Blot: Lamin A + C Antibody [NBP1-85550]

Western Blot: Lamin A + C Antibody [NBP1-85550]

Western Blot: Lamin A + C Antibody [NBP1-85550] - Lamin A Antibody [NBP1-85550] - Analysis in human cell lines PC-3 and HEK293. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunohistochemistry-Paraffin: Lamin A + C Antibody [NBP1-85550]

Immunohistochemistry-Paraffin: Lamin A + C Antibody [NBP1-85550]

Immunohistochemistry-Paraffin: Lamin A Antibody [NBP1-85550] - Staining of human fallopian tube shows moderate positivity in nuclear membrane in glandular cells.
Immunohistochemistry-Paraffin: Lamin A + C Antibody [NBP1-85550]

Immunohistochemistry-Paraffin: Lamin A + C Antibody [NBP1-85550]

Immunohistochemistry-Paraffin: Lamin A Antibody [NBP1-85550] - Staining of human prostate shows strong positivity in nuclear membrane in smooth muscle cells and glandular cells.
Immunohistochemistry-Paraffin: Lamin A + C Antibody [NBP1-85550]

Immunohistochemistry-Paraffin: Lamin A + C Antibody [NBP1-85550]

Immunohistochemistry-Paraffin: Lamin A Antibody [NBP1-85550] - Staining of human stomach shows strong positivity in nuclear membrane in glandular cells.
Immunohistochemistry-Paraffin: Lamin A + C Antibody [NBP1-85550]

Immunohistochemistry-Paraffin: Lamin A + C Antibody [NBP1-85550]

Immunohistochemistry-Paraffin: Lamin A Antibody [NBP1-85550] - Staining of human skin shows strong positivity in nuclear membrane in squamous epithelial cells.
Lamin A + C Antibody

Western Blot: Rabbit Polyclonal Lamin A + C Antibody [NBP1-85550] -

Western Blot: Rabbit Polyclonal Lamin A + C Antibody [NBP1-85550] - Western blot showing over-expression of lamin A/C tagged with mKate, as well as endogenous lamin A/C, in zebrafish embryos. Actin used as loading control. Image from a verified customer review.

Applications for Lamin A + C Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 2 reviews rated 4.5 using NBP1-85550 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lamin A + C

Lamins are a class of intermediate filament proteins that form a matrix on the inner surface of the nuclear envelope. These proteins are found in many different cell types in three different forms (A, B, and C). Lamins A and C are alternatively spliced versions of the LMNA gene. The LMNA gene has been linked to many disorders of the muscular system, nervous system, and the fat distributions systems including: Emery-Dreifuss muscular dystrophy, Dunnigan-type familial partial lipodystrophy (FPLD), limb-girdle muscular dystrophy (LGMD1B), dilated cardiomyopathy (CMD1A), axonal neuropathy (Charcot-Marie-Tooth disease; CMT2B1), and mandibuloacral dysplasia (MAD).

Alternate Names

CDCD1, CDDC, CMD1A, CMT2B1, dilated 1A (autosomal dominant), EMD2, FPLD, HGPSFPL, lamin A/C, lamin A/C-like 1, lamin-A/C, LDP1, LFP, LGMD1B, limb girdle muscular dystrophy 1B (autosomal dominant), LMN1IDC, LMNC, LMNL1, prelamin-A/C, PRO1,70 kDa lamin, progeria 1 (Hutchinson-Gilford type), renal carcinoma antigen NY-REN-32

Entrez Gene IDs

4000 (Human); 16905 (Mouse); 60374 (Rat)

Gene Symbol

LMNA

UniProt

P02545 (Mouse)

Additional Lamin A + C Products

Product Documents for Lamin A + C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Lamin A + C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lamin A + C Antibody - BSA Free (2)

4.5 out of 5
2 Customer Ratings
5 Stars
50%
4 Stars
50%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Lamin A + C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • Lamin A + C Antibody
    Name: João Coelho
    Application: Western Blot
    Sample Tested: zebrafish embryos
    Species: Zebrafish
    Verified Customer | Posted 11/06/2023
    Western blot showing over-expression of lamin A/C tagged with mKate, as well as endogenous lamin A/C, in zebrafish embryos. Actin used as loading control.
    Lamin A + C Antibody - BSA Free NBP1-85550
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
  • Name: Ramanath Narayana Hegde
    Application: Western Blot
    Sample Tested:
    Species: Human
    Verified Customer | Posted 05/21/2015
    Lamin A From HeLa Cells Using Lamin A antibody NB600-1036
    Lamin A + C Antibody - BSA Free NBP1-85550

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies