Lamin B2 Antibody (1S9M6)

Novus Biologicals | Catalog # NBP3-16527

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1S9M6 expressed in HEK293
View all Lamin B2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 521-620 of human Lamin B2 (Q03252). YILRAGQMVTVWAAGAGVAHSPPSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lamin B2 Antibody (1S9M6)

Western Blot: Lamin B2 Antibody (1S9M6) [NBP3-16527]

Western Blot: Lamin B2 Antibody (1S9M6) [NBP3-16527]

Western Blot: Lamin B2 Antibody (1S9M6) [NBP3-16527] - Western blot analysis of extracts of various cell lines, using Lamin B2 Rabbit mAb (NBP3-16527) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: Lamin B2 Antibody (1S9M6) [NBP3-16527]

Immunocytochemistry/ Immunofluorescence: Lamin B2 Antibody (1S9M6) [NBP3-16527]

Immunocytochemistry/Immunofluorescence: Lamin B2 Antibody (1S9M6) [NBP3-16527] - Immunofluorescence analysis of U-2 OS cells using Lamin B2 Rabbit mAb (NBP3-16527) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Lamin B2 Antibody (1S9M6) [NBP3-16527]

Immunohistochemistry-Paraffin: Lamin B2 Antibody (1S9M6) [NBP3-16527]

Immunohistochemistry-Paraffin: Lamin B2 Antibody (1S9M6) [NBP3-16527] - Immunohistochemistry of paraffin-embedded mouse spinal cord using Lamin B2 Rabbit mAb (NBP3-16527) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Lamin B2 Antibody (1S9M6) [NBP3-16527]

Immunohistochemistry-Paraffin: Lamin B2 Antibody (1S9M6) [NBP3-16527]

Immunohistochemistry-Paraffin: Lamin B2 Antibody (1S9M6) [NBP3-16527] - Immunohistochemistry of paraffin-embedded rat brain using Lamin B2 Rabbit mAb (NBP3-16527) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Lamin B2 Antibody (1S9M6) [NBP3-16527]

Immunohistochemistry-Paraffin: Lamin B2 Antibody (1S9M6) [NBP3-16527]

Immunohistochemistry-Paraffin: Lamin B2 Antibody (1S9M6) [NBP3-16527] - Immunohistochemistry of paraffin-embedded human thyroid cancer using Lamin B2 Rabbit mAb (NBP3-16527) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Lamin B2 Antibody (1S9M6)

Immunohistochemistry: Lamin B2 Antibody (1S9M6) [NBP3-16527] -

Immunohistochemistry: Lamin B2 Antibody (1S9M6) [NBP3-16527] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Lamin B2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Lamin B2 Antibody (1S9M6)

Immunohistochemistry: Lamin B2 Antibody (1S9M6) [NBP3-16527] -

Immunohistochemistry: Lamin B2 Antibody (1S9M6) [NBP3-16527] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Lamin B2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Lamin B2 Antibody (1S9M6)

Immunocytochemistry/ Immunofluorescence: Lamin B2 Antibody (1S9M6) [NBP3-16527] -

Immunocytochemistry/ Immunofluorescence: Lamin B2 Antibody (1S9M6) [NBP3-16527] - Confocal imaging of HeLa cells using Lamin B2 Rabbit mAb. The cells were counterstained with alpha-Tubulin Rabbit mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
Lamin B2 Antibody (1S9M6)

Immunohistochemistry: Lamin B2 Antibody (1S9M6) [NBP3-16527] -

Immunohistochemistry: Lamin B2 Antibody (1S9M6) [NBP3-16527] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Lamin B2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Lamin B2 Antibody (1S9M6)

Immunohistochemistry: Lamin B2 Antibody (1S9M6) [NBP3-16527] -

Immunohistochemistry: Lamin B2 Antibody (1S9M6) [NBP3-16527] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Lamin B2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Lamin B2 Antibody (1S9M6)

Immunohistochemistry: Lamin B2 Antibody (1S9M6) [NBP3-16527] -

Immunohistochemistry: Lamin B2 Antibody (1S9M6) [NBP3-16527] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Lamin B2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Lamin B2 Antibody (1S9M6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lamin B2

An important part of the cell nucleus is formed by nuclear lamina. Nuclear lamins form a network of filaments at the nucleoplasmic site of the nuclear membrane. Two main subtypes of nuclear lamins can be distinguished, i.e. A-type lamins and B-type lamins. The A-type lamins comprise a set of three proteins arising from the same gene by alternative splicing, i.e. Lamin A, Lamin C and lamin Adel10, while the B-type lamins include two proteins arising from two distinct genes, i.e. Lamin B1 and Lamin B2. The nuclear lamins comprise a unique subclass of the intermediate filament protein family. They share a molecular domain organisation with the other intermediate filament proteins in that they are fibrous molecules that have an aminoterminal globular head, a central rod of a-helices and a carboxyterminal globular domain. Many biochemical and molecular features of lamins have been studied, but their functions remain still largely undetermined. One of the functions ascribed to the lamina is the maintenance of the structural integrity of the nucleus. Besides interactions with the nuclear membrane and other intermediate filaments, lamins interact with the nuclear chromatin. Eukaryotic chromatin is organized into loops, which are attached to the nuclear matrix. This organization is thought to contribute to compaction of the chromatin and regulation of gene expression. Lamins, as part of the nuclear matrix, may be involved in these processes since chromatin binding sites have been detected in both A- and B-type lamins.

Alternate Names

lamin B2, lamin-B2, LMN2LAMB2, MGC2721

Gene Symbol

LMNB2

Additional Lamin B2 Products

Product Documents for Lamin B2 Antibody (1S9M6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Lamin B2 Antibody (1S9M6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lamin B2 Antibody (1S9M6)

There are currently no reviews for this product. Be the first to review Lamin B2 Antibody (1S9M6) and earn rewards!

Have you used Lamin B2 Antibody (1S9M6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lamin B2 Antibody (1S9M6)

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?

    A:

    We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies