Laminin alpha 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89955

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Laminin alpha 3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22892598)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Laminin alpha 3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Laminin alpha 3 Antibody [NBP1-89955]

Immunocytochemistry/ Immunofluorescence: Laminin alpha 3 Antibody [NBP1-89955]

Immunocytochemistry/Immunofluorescence: Laminin alpha 3 Antibody [NBP1-89955] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Laminin alpha 3 Antibody - BSA Free Immunohistochemistry-Paraffin: Laminin alpha 3 Antibody - BSA Free [NBP1-89955]

Immunohistochemistry-Paraffin: Laminin alpha 3 Antibody - BSA Free [NBP1-89955]

Analysis in human small intestine and tonsil tissues using NBP1-89955 antibody. Corresponding LAMA3 RNA-seq data are presented for the same tissues.
Laminin alpha 3 Antibody - BSA Free Immunohistochemistry-Paraffin: Laminin alpha 3 Antibody - BSA Free [NBP1-89955]

Immunohistochemistry-Paraffin: Laminin alpha 3 Antibody - BSA Free [NBP1-89955]

Staining of human small intestine shows moderate positivity in basement membrane of glandular cells.
Laminin alpha 3 Antibody - BSA Free Immunohistochemistry-Paraffin: Laminin alpha 3 Antibody - BSA Free [NBP1-89955]

Immunohistochemistry-Paraffin: Laminin alpha 3 Antibody - BSA Free [NBP1-89955]

Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Laminin alpha 3 Antibody - BSA Free Immunohistochemistry-Paraffin: Laminin alpha 3 Antibody - BSA Free [NBP1-89955]

Immunohistochemistry-Paraffin: Laminin alpha 3 Antibody - BSA Free [NBP1-89955]

Staining of human skin shows moderate positivity in basement membrane of epithelial cells.
Laminin alpha 3 Antibody - BSA Free Immunohistochemistry-Paraffin: Laminin alpha 3 Antibody - BSA Free [NBP1-89955]

Immunohistochemistry-Paraffin: Laminin alpha 3 Antibody - BSA Free [NBP1-89955]

Staining of human prostate shows weak to moderate positivity in basement membrane of glandular cells.

Applications for Laminin alpha 3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF: Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Laminin alpha 3

Laminins are basement membrane components thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. The protein encoded by this gene is the alpha-3 subunit of laminin 5, which is a complex glycoprotein composed of three subunits (alpha, beta, and gamma). Laminin 5 is thought to be involved in cell adhesion, signal transduction and differentiation of keratinocytes. Mutations in this gene have been identified as the cause of Herlitz type junctional epidermolysis bullosa. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. (provided by RefSeq)

Alternate Names

BM600, BM600 150kD subunit, BM600-150kDa, E170, epiligrin, Epiligrin 170 kDa subunit, epiligrin alpha 3 subunit, Epiligrin subunit alpha, kalinin 165kD subunit, Kalinin subunit alpha, kalinin-165kDa, lama3a, laminin subunit alpha-3, laminin, alpha 3, laminin, alpha 3 (nicein (150kD), kalinin (165kD), BM600 (150kD), epilegrin), laminin-5 alpha 3 chain, Laminin-5 subunit alpha, Laminin-6 subunit alpha, Laminin-7 subunit alpha, LAMNA, LOCS, nicein 150kD subunit, Nicein subunit alpha, nicein-150kDa

Gene Symbol

LAMA3

Additional Laminin alpha 3 Products

Product Documents for Laminin alpha 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Laminin alpha 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Laminin alpha 3 Antibody - BSA Free

Customer Reviews for Laminin alpha 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Laminin alpha 3 Antibody - BSA Free and earn rewards!

Have you used Laminin alpha 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies