Laminin beta 1 Antibody (6I9T4)

Novus Biologicals | Catalog # NBP3-16392

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6I9T4 expressed in HEK293
View all Laminin beta 1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1687-1786 of human Laminin beta 1 (P07942). KKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

198 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Laminin beta 1 Antibody (6I9T4)

Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]

Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]

Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Western blot analysis of extracts of Rat lung, using Laminin beta 1 Rabbit mAb (NBP3-16392) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]

Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]

Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Western blot analysis of extracts of Mouse heart, using Laminin beta 1 Rabbit mAb (NBP3-16392) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]

Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392]

Western Blot: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Western blot analysis of extracts of HepG2 cells, using Laminin beta 1 Rabbit mAb (NBP3-16392) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
Laminin beta 1 Antibody (6I9T4)

Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] -

Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Confocal imaging of NIH/3T3 cells using Laminin beta 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Laminin beta 1 Antibody (6I9T4)

Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] -

Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Confocal imaging of Hep G2 cells using Laminin beta 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Laminin beta 1 Antibody (6I9T4)

Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] -

Immunocytochemistry/ Immunofluorescence: Laminin beta 1 Antibody (6I9T4) [NBP3-16392] - Confocal imaging of C6 cells using Laminin beta 1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for Laminin beta 1 Antibody (6I9T4)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:200 - 1:800

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Laminin beta 1

Laminins are essential and abundant structural non-collagenous glycoproteins localizing to basement membranes. Basement membranes (cell-associated extracellular matrices (ECMs)) are polymers of Laminins with stabilizing type IV collagen networks, nidogen and several proteoglycans. Basement membranes are found under epithelial layers, around the endothelium of blood vessels and surrounding muscle, peripheral nerve and fat cells. Formation of basement membranes influences cell proliferation, phenotype, migration, gene expression and tissue architecture. Each Laminin is a heterotrimer of alpha, beta and gamma chain subunits that undergoes cell-secretion and incorporation into the ECM. Laminins can self-assemble and bind to other matrix macromolecules, and have unique and shared cell interactions mediated by Integrins, dystroglycan and cognate Laminin receptors. The human Laminin gamma-1 gene maps to chromosome 1q31 and is ubiquitously expressed in tissues that produce basement membranes.

Alternate Names

CLM, cutis laxa with marfanoid phenotype, Laminin B1 chain, laminin subunit beta-1, laminin, beta 1, Laminin-1 subunit beta, Laminin-10 subunit beta, Laminin-12 subunit beta, Laminin-2 subunit beta, Laminin-6 subunit beta, Laminin-8 subunit beta, MGC142015

Gene Symbol

LAMB1

Additional Laminin beta 1 Products

Product Documents for Laminin beta 1 Antibody (6I9T4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Laminin beta 1 Antibody (6I9T4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Laminin beta 1 Antibody (6I9T4)

There are currently no reviews for this product. Be the first to review Laminin beta 1 Antibody (6I9T4) and earn rewards!

Have you used Laminin beta 1 Antibody (6I9T4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies