Laminin gamma 1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-87718
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVS
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%), Mouse (86%).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Laminin gamma 1 Antibody - BSA Free
Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718]
Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human cerebral cortex, kidney, placenta and tonsil using Anti-LAMC1 antibody NBP1-87718 (A) shows similar protein distribution across tissues to independent antibody NBP1-87719 (B).Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718]
Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human tonsil using Anti-LAMC1 antibody NBP1-87718.Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718]
Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human placenta shows high expression.Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718]
Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human tonsil shows low expression as expected.Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718]
Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human cerebral cortex.Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718]
Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human kidney.Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718]
Immunohistochemistry-Paraffin: Laminin gamma 1 Antibody [NBP1-87718] - Staining of human placenta using Anti-LAMC1 antibody NBP1-87718.Simple Western: Laminin gamma 1 Antibody [NBP1-87718]
Simple Western: Laminin gamma 1 Antibody [NBP1-87718] - Simple Western lane view shows a specific band for LAMC1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.Simple Western: Laminin gamma 1 Antibody [NBP1-87718]
Simple Western: Laminin gamma 1 Antibody [NBP1-87718] - Electropherogram image(s) of corresponding Simple Western lane view. Laminin gamma 1 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).Applications for Laminin gamma 1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200-1:500
Simple Western
1:20
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 267, 264 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 267, 264 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Laminin gamma 1
Alternate Names
LAMC1, Laminin B2
Gene Symbol
LAMC1
Additional Laminin gamma 1 Products
Product Documents for Laminin gamma 1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Laminin gamma 1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Laminin gamma 1 Antibody - BSA Free
Customer Reviews for Laminin gamma 1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Laminin gamma 1 Antibody - BSA Free and earn rewards!
Have you used Laminin gamma 1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...