LDB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85573

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LDB1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LDB1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: LDB1 Antibody [NBP1-85573]

Immunocytochemistry/ Immunofluorescence: LDB1 Antibody [NBP1-85573]

Immunocytochemistry/Immunofluorescence: LDB1 Antibody [NBP1-85573] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
LDB1 Antibody - BSA Free Western Blot: LDB1 Antibody - BSA Free [NBP1-85573]

Western Blot: LDB1 Antibody - BSA Free [NBP1-85573]

Analysis in human cell line SH-SY5Y.
LDB1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: LDB1 Antibody - BSA Free [NBP1-85573]

Chromatin Immunoprecipitation-exo-Seq: LDB1 Antibody - BSA Free [NBP1-85573]

ChIP-Exo-Seq composite graph for Anti-LDB1 (NBP1-85573) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.
LDB1 Antibody - BSA Free Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-85573]

Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-85573]

Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
LDB1 Antibody - BSA Free Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-85573]

Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-85573]

Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
LDB1 Antibody - BSA Free Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-85573]

Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-85573]

Staining of human bone marrow shows strong nuclear positivity in a subset of hematopoietic cells.
LDB1 Antibody - BSA Free Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-85573]

Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-85573]

Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Applications for LDB1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LDB1

LDB1 binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. May regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. May play a role in the development of motor neuron

Alternate Names

carboxy terminal LIM domain protein 2, Carboxyl-terminal LIM domain-binding protein 2, CLIM-2, CLIM2hLdb1, LDB-1, LIM domain binding 1, LIM domain-binding factor-1, LIM domain-binding protein 1, NLILIM domain-binding factor CLIM2, Nuclear LIM interactor

Gene Symbol

LDB1

Additional LDB1 Products

Product Documents for LDB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LDB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for LDB1 Antibody - BSA Free

Customer Reviews for LDB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LDB1 Antibody - BSA Free and earn rewards!

Have you used LDB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies