LEMD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57649

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LEMD3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('GELSIENPFGETFGKIQESEKTLMMNTLYKLHDRLAQLAGDHECGSSSQRTLSVQEAAAYLKDLGPEYEGIFNTSLQWILENGKDVGIRCVGFGPE',)

Reactivity Notes

Mouse( 81%), Rat( 80%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LEMD3 Antibody - BSA Free

Western Blot: LEMD3 Antibody [NBP2-57649]

Western Blot: LEMD3 Antibody [NBP2-57649]

Western Blot: LEMD3 Antibody [NBP2-57649] - Analysis using Anti-LEMD3 antibody NBP2-57649 (A) shows similar pattern to independent antibody NBP1-81265 (B).
Immunocytochemistry/ Immunofluorescence: LEMD3 Antibody [NBP2-57649]

Immunocytochemistry/ Immunofluorescence: LEMD3 Antibody [NBP2-57649]

Immunocytochemistry/Immunofluorescence: LEMD3 Antibody [NBP2-57649] - Staining of human cell line RT4 shows localization to nuclear membrane.

Applications for LEMD3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LEMD3

The MAN antigens, such as MAN1, are nuclear membrane proteins that are recognized by autoantibodies from a patient with a collagen vascular disease. Because MAN1 contains an LEM domain, the gene is also called LEMD3 (for 'LEM domain-containing-3').[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

inner nuclear membrane protein Man1, integral inner nuclear membrane protein, LEM domain containing 3, MAN1LEM domain-containing protein 3

Gene Symbol

LEMD3

Additional LEMD3 Products

Product Documents for LEMD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LEMD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LEMD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LEMD3 Antibody - BSA Free and earn rewards!

Have you used LEMD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies