Leukotriene B4 Receptor 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57352

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Leukotriene B4 R2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL

Reactivity Notes

Rat 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Leukotriene B4 Receptor 2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Leukotriene B4 Receptor 2 Antibody [NBP2-57352]

Immunocytochemistry/ Immunofluorescence: Leukotriene B4 Receptor 2 Antibody [NBP2-57352]

Immunocytochemistry/Immunofluorescence: Leukotriene B4 Receptor 2 Antibody [NBP2-57352] - Staining of human cell line A549 shows localization to nucleoplasm & plasma membrane.

Applications for Leukotriene B4 Receptor 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Leukotriene B4 R2

LUSTR2 is an Orphan-U GPCR with an unknown ligand. ESTs have been isolated from human tissue libraries, especially normal kidney, ovary and pituitary, and cancerous bladder, duodenum, genitourinary tract and placenta.

Long Name

Leukotriene B4 Receptor 2

Alternate Names

BLT2, BLTR2, JULF2, Leukotriene B4R2, LTB4R2, NOP9

Gene Symbol

LTB4R2

Additional Leukotriene B4 R2 Products

Product Documents for Leukotriene B4 Receptor 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Leukotriene B4 Receptor 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Leukotriene B4 Receptor 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Leukotriene B4 Receptor 2 Antibody - BSA Free and earn rewards!

Have you used Leukotriene B4 Receptor 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies