LHX2 Antibody (1E6) - Azide and BSA Free

Novus Biologicals | Catalog # H00009355-M02

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 1E6

Format

Azide and BSA Free
View all LHX2 Primary Antibodies »

Product Specifications

Immunogen

LHX2 (NP_004780, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMR

Specificity

LHX2 - LIM homeobox 2 (1E6)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for LHX2 Antibody (1E6) - Azide and BSA Free

Western Blot: LHX2 Antibody (1E6) [H00009355-M02]

Western Blot: LHX2 Antibody (1E6) [H00009355-M02]

Western Blot: LHX2 Antibody (1E6) [H00009355-M02] - Analysis of LHX2 expression in transfected 293T cell line by LHX2 monoclonal antibody (M02), clone 1E6.Lane 1: LHX2 transfected lysate(44.4 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: LHX2 Antibody (1E6) [H00009355-M02]

Immunocytochemistry/ Immunofluorescence: LHX2 Antibody (1E6) [H00009355-M02]

Immunocytochemistry/Immunofluorescence: LHX2 Antibody (1E6) [H00009355-M02] - Analysis of monoclonal antibody to LHX2 on HeLa cell. Antibody concentration 10 ug/ml.

Applications for LHX2 Antibody (1E6) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: LHX2

This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution. [provided by RefSeq]

Alternate Names

hLhx2, Homeobox protein LH-2, LH-2, LH2MGC138390, LIM homeobox 2, LIM homeobox protein 2, LIM HOX gene 2, LIM/homeobox protein Lhx2

Entrez Gene IDs

9355 (Human)

Gene Symbol

LHX2

UniProt

NP_004780 (Human)

Additional LHX2 Products

Product Documents for LHX2 Antibody (1E6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LHX2 Antibody (1E6) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LHX2 Antibody (1E6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review LHX2 Antibody (1E6) - Azide and BSA Free and earn rewards!

Have you used LHX2 Antibody (1E6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies