LIS1 Antibody (9O6X3)

Novus Biologicals | Catalog # NBP3-16253

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9O6X3 expressed in HEK293
View all LIS1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LIS1 (P43034). MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for LIS1 Antibody (9O6X3)

Western Blot: LIS1 Antibody (9O6X3) [NBP3-16253]

Western Blot: LIS1 Antibody (9O6X3) [NBP3-16253]

Western Blot: LIS1 Antibody (9O6X3) [NBP3-16253] - Western blot analysis of extracts of various cell lines, using LIS1 antibody (NBP3-16253) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.
Immunocytochemistry/ Immunofluorescence: LIS1 Antibody (9O6X3) [NBP3-16253]

Immunocytochemistry/ Immunofluorescence: LIS1 Antibody (9O6X3) [NBP3-16253]

Immunocytochemistry/Immunofluorescence: LIS1 Antibody (9O6X3) [NBP3-16253] - Immunofluorescence analysis of U-2 OS cells using LIS1 Rabbit mAb (NBP3-16253) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
LIS1 Antibody (9O6X3)

Immunocytochemistry/ Immunofluorescence: LIS1 Antibody (9O6X3) [NBP3-16253] -

Immunocytochemistry/ Immunofluorescence: LIS1 Antibody (9O6X3) [NBP3-16253] - Immunofluorescence analysis of NIH-3T3 cells using LIS1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
LIS1 Antibody (9O6X3)

Immunocytochemistry/ Immunofluorescence: LIS1 Antibody (9O6X3) [NBP3-16253] -

Immunocytochemistry/ Immunofluorescence: LIS1 Antibody (9O6X3) [NBP3-16253] - Immunofluorescence analysis of C6 cells using LIS1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for LIS1 Antibody (9O6X3)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

0.5μg-4μg antibody for 400 ug-600ug extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: LIS1

Lissencephaly (LIS), literally meaning smooth brain, has multiple causes. Agyria, i.e., brain without convolutions or gyri, was considered a rare malformation until recent progress in neuroradiology. With this technical advantage, a number of lissencephaly syndromes have been distinguished. Classic lissencephaly (type I) is a brain malformation caused by abnormal neuronal migration at 9 to 13 weeks' gestation, resulting in a spectrum of agyria, mixed agyria / pachygyria, and pachygyria. It is characterized by an abnormally thick and poorly organized cortex with 4 primitive layers, diffuse neuronal heterotopia, enlarged and dysmorphic ventricles, and often hypoplasia of the corpus callosum. Lissencephaly is found in association with facial abnormalities in Miller-Dieker syndrome and without other major anomalies in X-linked lissencephaly and isolated lissencephaly sequence (ILS). Subcortical band heterotopia (SBH) are bilateral and symmetric ribbons of gray matter found in the central white matter between the cortex and the ventricular surface and comprise the less severe end of the lissencephaly spectrum of malformations.

Alternate Names

LIS-1, LIS1PAF-AH alpha, LIS2, lissencephaly 1 protein, Lissencephaly-1 protein, MDCR, MDS, Miller-Dieker syndrome chromosome region, PAF acetylhydrolase 45 kDa subunit, PAFAH, PAF-AH 45 kDa subunit, PAFAH alpha, PAFAHA, platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa), platelet-activating factor acetylhydrolase IB subunit alpha, platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit (45kD), platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa, platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa)

Gene Symbol

PAFAH1B1

Additional LIS1 Products

Product Documents for LIS1 Antibody (9O6X3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LIS1 Antibody (9O6X3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LIS1 Antibody (9O6X3)

There are currently no reviews for this product. Be the first to review LIS1 Antibody (9O6X3) and earn rewards!

Have you used LIS1 Antibody (9O6X3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies