Lysyl tRNA synthetase Antibody (2V2B6)

Novus Biologicals | Catalog # NBP3-16670

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2V2B6 expressed in HEK293
View all Lysyl tRNA synthetase Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 500-597 of human Lysyl tRNA synthetase (Q15046). TELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lysyl tRNA synthetase Antibody (2V2B6)

Western Blot: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Western Blot: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Western Blot: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Western blot analysis of extracts of various cell lines, using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunocytochemistry/ Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunocytochemistry/Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunofluorescence analysis of U-2 OS cells using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunohistochemistry of paraffin-embedded mouse spinal cord using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunocytochemistry/ Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunocytochemistry/Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunofluorescence analysis of C6 cells using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunocytochemistry/ Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunocytochemistry/Immunofluorescence: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunofluorescence analysis of NIH-3T3 cells using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670]

Immunohistochemistry-Paraffin: Lysyl tRNA synthetase Antibody (2V2B6) [NBP3-16670] - Immunohistochemistry of paraffin-embedded rat testis using Lysyl tRNA synthetase Rabbit mAb (NBP3-16670) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Lysyl tRNA synthetase Antibody (2V2B6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Lysyl tRNA synthetase

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis

Alternate Names

CMTRIB, EC 6.1.1, EC 6.1.1.6, KARS2, KIAA0070, KRS, lysine tRNA ligase, Lysine--tRNA ligase, lysRS, lysyl-tRNA synthetase

Gene Symbol

KARS1

Additional Lysyl tRNA synthetase Products

Product Documents for Lysyl tRNA synthetase Antibody (2V2B6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Lysyl tRNA synthetase Antibody (2V2B6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lysyl tRNA synthetase Antibody (2V2B6)

There are currently no reviews for this product. Be the first to review Lysyl tRNA synthetase Antibody (2V2B6) and earn rewards!

Have you used Lysyl tRNA synthetase Antibody (2V2B6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies