MAD2L1-binding protein Antibody (7W8H1)

Name: MAD2L1-binding protein Antibody (7W8H1)
Brand: Novus Biologicals
SKU: NBP3-33204
Price: 449 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-33204

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 7W8H1

View all MAD2L1-binding protein Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 175-274 of human MAD2L1-binding protein (Q15013).

Sequence:
YSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MAD2L1-binding protein Antibody (7W8H1)

Immunohistochemistry: MAD2L1-binding protein Antibody (7W8H1) [NBP3-33204] -

Immunohistochemistry: MAD2L1-binding protein Antibody (7W8H1) [NBP3-33204] - Immunohistochemistry analysis of paraffin-embedded Human colon using MAD2L1-binding protein Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Western Blot: MAD2L1-binding protein Antibody (7W8H1) [NBP3-33204] -

Western Blot: MAD2L1-binding protein Antibody (7W8H1) [NBP3-33204] - Western blot analysis of various lysates using MAD2L1-binding protein Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for MAD2L1-binding protein Antibody (7W8H1)

Application

Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MAD2L1-binding protein

MAD2L1-binding protein is encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Alternate Names

Caught by MAD2 protein, CMT2MGC11282, dJ261G23.1, KIAA0110RP1-261G23.6, MAD2L1 binding protein, MAD2L1-binding protein

Gene Symbol

MAD2L1BP

Additional MAD2L1-binding protein Products

Product Documents for MAD2L1-binding protein Antibody (7W8H1)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MAD2L1-binding protein Antibody (7W8H1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAD2L1-binding protein Antibody (7W8H1)

There are currently no reviews for this product. Be the first to review MAD2L1-binding protein Antibody (7W8H1) and earn rewards!

Have you used MAD2L1-binding protein Antibody (7W8H1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image