MAD2L2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35251

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-211 of human MAD2L2 (NP_006332.3).

Sequence:
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MAD2L2 Antibody - BSA Free

MAD2L2 Antibody

Immunocytochemistry/ Immunofluorescence: MAD2L2 Antibody [NBP3-35251] -

Immunocytochemistry/ Immunofluorescence: MAD2L2 Antibody [NBP3-35251] - Immunofluorescence analysis of L929 cells using MAD2L2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
MAD2L2 Antibody

Western Blot: MAD2L2 Antibody [NBP3-35251] -

Western Blot: MAD2L2 Antibody [NBP3-35251] - Western blot analysis of various lysates using MAD2L2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
MAD2L2 Antibody

Immunocytochemistry/ Immunofluorescence: MAD2L2 Antibody [NBP3-35251] -

Immunocytochemistry/ Immunofluorescence: MAD2L2 Antibody [NBP3-35251] - Immunofluorescence analysis of U2OS cells using MAD2L2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
MAD2L2 Antibody

Immunocytochemistry/ Immunofluorescence: MAD2L2 Antibody [NBP3-35251] -

Immunocytochemistry/ Immunofluorescence: MAD2L2 Antibody [NBP3-35251] - Immunofluorescence analysis of H9C2 cells using MAD2L2 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for MAD2L2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MAD2L2

MAD2L2 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L2 is a homolog of MAD2L1.

Alternate Names

hREV7, MAD2 mitotic arrest deficient-like 2 (yeast), MAD2BREV7 homolog, MAD2-like protein 2, Mitotic arrest deficient 2-like protein 2, mitotic arrest deficient homolog-like 2, mitotic spindle assembly checkpoint protein MAD2B, REV7yeast, homolog)-like 2

Gene Symbol

MAD2L2

Additional MAD2L2 Products

Product Documents for MAD2L2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MAD2L2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAD2L2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAD2L2 Antibody - BSA Free and earn rewards!

Have you used MAD2L2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...