MAN1A2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82802
![Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]](https://beta-resources.rndsystems.com/images/products/MAN1A2-Antibody-Immunohistochemistry-Paraffin-NBP1-82802-img0013.jpg "Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit MAN1A2 Antibody - BSA Free (NBP1-82802) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MAN1A2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for MAN1A2 Antibody - BSA Free
![Western Blot: MAN1A2 Antibody [NBP1-82802]](https://beta-resources.rndsystems.com/images/products/MAN1A2-Antibody-Western-Blot-NBP1-82802-img0005.jpg "Western Blot: MAN1A2 Antibody [NBP1-82802]")
Western Blot: MAN1A2 Antibody [NBP1-82802]
Western Blot: MAN1A2 Antibody [NBP1-82802] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-330![Immunocytochemistry/ Immunofluorescence: MAN1A2 Antibody [NBP1-82802]](https://beta-resources.rndsystems.com/images/products/MAN1A2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82802-img0008.jpg "Immunocytochemistry/ Immunofluorescence: MAN1A2 Antibody [NBP1-82802]")
Immunocytochemistry/ Immunofluorescence: MAN1A2 Antibody [NBP1-82802]
Immunocytochemistry/Immunofluorescence: MAN1A2 Antibody [NBP1-82802] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]](https://beta-resources.rndsystems.com/images/products/MAN1A2-Antibody-Immunohistochemistry-Paraffin-NBP1-82802-img0009.jpg "Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]")
Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]
Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.![Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]](https://beta-resources.rndsystems.com/images/products/MAN1A2-Antibody-Immunohistochemistry-Paraffin-NBP1-82802-img0010.jpg "Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]")
Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]
Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human placenta shows strong granular cytoplasmic positivity in trophoblastic cells.![Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]](https://beta-resources.rndsystems.com/images/products/MAN1A2-Antibody-Immunohistochemistry-Paraffin-NBP1-82802-img0011.jpg "Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]")
Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]
Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.![Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]](https://beta-resources.rndsystems.com/images/products/MAN1A2-Antibody-Immunohistochemistry-Paraffin-NBP1-82802-img0012.jpg "Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]")
Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802]
Immunohistochemistry-Paraffin: MAN1A2 Antibody [NBP1-82802] - Staining of human skeletal muscle shows very weak positivity in myocytes.Applications for MAN1A2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 24591635). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 4 using NBP1-82802 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MAN1A2
Long Name
Mannosidase alpha, Class 1A, Member 2
Alternate Names
MAN1B
Entrez Gene IDs
10905 (Human)
Gene Symbol
MAN1A2
UniProt
Additional MAN1A2 Products
Product Documents for MAN1A2 Antibody - BSA Free
Product Specific Notices for MAN1A2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for MAN1A2 Antibody - BSA Free
Powered by Bioz
Customer Reviews for MAN1A2 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used MAN1A2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested:Species: HumanVerified Customer | Posted 04/28/2014
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...