MAP2 Antibody
Novus Biologicals | Catalog # NBP1-81263
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVT
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)
Marker
Neuronal Dendritic Marker
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for MAP2 Antibody
Immunocytochemistry/ Immunofluorescence: MAP2 Antibody [NBP1-81263]
Immunocytochemistry/Immunofluorescence: MAP2 Antibody [NBP1-81263] - Staining of human cell line A-431 shows localization to nucleoli & cytosol.Applications for MAP2 Antibody
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: MAP2
MAP2 isoforms are developmentally regulated and differentially expressed in neurons and some glia. MAP2c is predominantly expressed in the developing brain while the other isoforms are expressed in the adult brain. The distribution of MAP2 isoforms also varies, with MAP2a and MAP2b predominantly localized to dendrites, while MAP2c is also found in axons. Lastly, the expression of MAP2d is not limited to neurons and may be found in glia, specifically oligodendrocytes (1, 2). MAP2 isoforms associate with microtubules and mediate their interaction with actin filaments thereby playing a critical role in organizing the microtubule-actin network. In neurons, MAP2 isoforms are implicated in different processes including neurite initiation, elongation and stabilization as well as axon and dendrite formation (2). Knockout of MAP expression in animal models results in a variety of functional and structural brain defects according to the isoform affected (e.g., reduced LTP and LTD, reduced myelination, absence of corpus collosum, motor system malfunction, abnormal hippocampal dendritic morphology, abnormal synaptic plasticity) (4).
References
1. Dehmelt, L., & Halpain, S. (2005). The MAP2/Tau family of microtubule-associated proteins. Genome Biology. https://doi.org/10.1186/gb-2004-6-1-204
2. Mohan, R., & John, A. (2015). Microtubule-associated proteins as direct crosslinkers of actin filaments and microtubules. IUBMB Life. https://doi.org/10.1002/iub.1384
3. Shafit-Zagardo, B., & Kalcheva, N. (1998). Making sense of the multiple MAP-2 transcripts and their role in the neuron. Molecular Neurobiology. https://doi.org/10.1007/BF02740642
4. Tortosa, E., Kapitein, L. C., & Hoogenraad, C. C. (2016). Microtubule organization and microtubule-associated proteins (MAPs). In Dendrites: Development and Disease. https://doi.org/10.1007/978-4-431-56050-0_3
Long Name
Microtubule-associated Protein 2
Alternate Names
DKFZp686I2148, MAP-2, MAP2A, MAP2B, MAP2C, Microtubule Associated Protein 2, microtubule-associated protein 2, MTAP2
Gene Symbol
MAP2
Additional MAP2 Products
Product Documents for MAP2 Antibody
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MAP2 Antibody
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for MAP2 Antibody
Customer Reviews for MAP2 Antibody
There are currently no reviews for this product. Be the first to review MAP2 Antibody and earn rewards!
Have you used MAP2 Antibody?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...