MASP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81259

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MASP2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MASP2 Antibody - BSA Free

Western Blot: MASP2 Antibody [NBP1-81259]

Western Blot: MASP2 Antibody [NBP1-81259]

Western Blot: MASP2 Antibody [NBP1-81259] - Analysis in human plasma.
Immunocytochemistry/ Immunofluorescence: MASP2 Antibody [NBP1-81259]

Immunocytochemistry/ Immunofluorescence: MASP2 Antibody [NBP1-81259]

Immunocytochemistry/Immunofluorescence: MASP2 Antibody [NBP1-81259] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus.

Applications for MASP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MASP2

The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria. Alternate splicing of this gene results in two transcript variants encoding two RARF components that are involved in the mannan-binding lectin pathway of complement activation. The longer isoform is cleaved into two chains which form a heterodimer linked by a disulfide bond. The encoded proteins are members of the trypsin family of peptidases. [provided by RefSeq]

Alternate Names

EC 3.4.21, EC 3.4.21.104, mannan-binding lectin serine peptidase 1 pseudogene 1, mannan-binding lectin serine peptidase 2, mannan-binding lectin serine protease 1 pseudogene 1, mannan-binding lectin serine protease 2, Mannose-binding protein-associated serine protease 2, MAP19, MASP1P1, MASP-2, MBL-associated plasma protein of 19 kD, MBL-associated serine protease 2, small MBL-associated protein, sMAP

Gene Symbol

MASP2

Additional MASP2 Products

Product Documents for MASP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MASP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MASP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MASP2 Antibody - BSA Free and earn rewards!

Have you used MASP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MASP2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: We wish to measure MASP-2 levels in human plasma. Are stored plasma (or serum) at -20 centigrade stabile for this measurement if only frozen once. Should we measure in duplicate or triplicate? Is plasma better than serum as I have both stored for the MASP-2 test? What would be the cost of a kit and how many samples would it measure? I assume there is no special equipment other than ELISA like stuff? What is the shelf life as I have holiday next month? Is the a list of equipment we need to run the kits so I can check it with our lab technicians.

    A: Once frozen samples should be fine for measurement. Generally, all experiments should be performed at least in triplicate so you can perform statistical analysis. MASP-2 should be detectable in both serum and plasma. Serum might yield cleaner signals since it is depleted of blood cells and clotting factors, but the depletion could, theoretically remove some MSAP-2 as well. Either type of sample should be suitable though. We currently have no MASP2 ELISA kits available. A list of our MASP2 antibodies can be found at this link if you would like to make your own. We guarantee all of our antibodies for 6 months from the receipt date.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies