MCM2 Antibody (0Q10S9)

Novus Biologicals | Catalog # NBP3-16066

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0Q10S9 expressed in HEK293
View all MCM2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCM2 (P49736). MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTEGPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MCM2 Antibody (0Q10S9)

Western Blot: MCM2 Antibody (0Q10S9) [NBP3-16066]

Western Blot: MCM2 Antibody (0Q10S9) [NBP3-16066]

Western Blot: MCM2 Antibody (0Q10S9) [NBP3-16066] - Western blot analysis of extracts of various cell lines, using MCM2 antibody (NBP3-16066) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 0.3s.
Immunocytochemistry/ Immunofluorescence: MCM2 Antibody (0Q10S9) [NBP3-16066]

Immunocytochemistry/ Immunofluorescence: MCM2 Antibody (0Q10S9) [NBP3-16066]

Immunocytochemistry/Immunofluorescence: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunofluorescence analysis of U2OS cells using MCM2 Rabbit mAb (NBP3-16066) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: MCM2 Antibody (0Q10S9) [NBP3-16066]

Immunocytochemistry/ Immunofluorescence: MCM2 Antibody (0Q10S9) [NBP3-16066]

Immunocytochemistry/Immunofluorescence: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunofluorescence analysis of NIH/3T3 cells using MCM2 Rabbit mAb (NBP3-16066) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: MCM2 Antibody (0Q10S9) [NBP3-16066]

Immunocytochemistry/ Immunofluorescence: MCM2 Antibody (0Q10S9) [NBP3-16066]

Immunocytochemistry/Immunofluorescence: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunofluorescence analysis of PC-12 cells using MCM2 Rabbit mAb (NBP3-16066) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
MCM2 Antibody (0Q10S9)

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] -

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using MCM2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MCM2 Antibody (0Q10S9)

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] -

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using MCM2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MCM2 Antibody (0Q10S9)

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] -

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using MCM2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MCM2 Antibody (0Q10S9)

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] -

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunohistochemistry analysis of paraffin-embedded Human stomach tissue using MCM2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MCM2 Antibody (0Q10S9)

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] -

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using MCM2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MCM2 Antibody (0Q10S9)

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] -

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using MCM2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MCM2 Antibody (0Q10S9)

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] -

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using MCM2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MCM2 Antibody (0Q10S9)

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] -

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using MCM2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MCM2 Antibody (0Q10S9)

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] -

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunohistochemistry analysis of paraffin-embedded Human thyroid tissue using MCM2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MCM2 Antibody (0Q10S9)

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] -

Immunohistochemistry: MCM2 Antibody (0Q10S9) [NBP3-16066] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using MCM2 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for MCM2 Antibody (0Q10S9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MCM2

MCM2 is encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7.

Long Name

Minichromosome Maintenance Protein 2

Alternate Names

BM28, CCNL1, cdc19, CDCL1, D3S3194, Mitotin

Gene Symbol

MCM2

Additional MCM2 Products

Product Documents for MCM2 Antibody (0Q10S9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MCM2 Antibody (0Q10S9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cell Cycle

Customer Reviews for MCM2 Antibody (0Q10S9)

There are currently no reviews for this product. Be the first to review MCM2 Antibody (0Q10S9) and earn rewards!

Have you used MCM2 Antibody (0Q10S9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies