MCM3 Antibody (9Z5W4)

Novus Biologicals | Catalog # NBP3-15386

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9Z5W4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCM3 (P25205). MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MCM3 Antibody (9Z5W4)

Western Blot: MCM3 Antibody (9Z5W4) [NBP3-15386]

Western Blot: MCM3 Antibody (9Z5W4) [NBP3-15386]

Western Blot: MCM3 Antibody (9Z5W4) [NBP3-15386] - Western blot analysis of extracts of Mouse spleen, using MCM3 Rabbit mAb (NBP3-15386) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: MCM3 Antibody (9Z5W4) [NBP3-15386]

Immunocytochemistry/ Immunofluorescence: MCM3 Antibody (9Z5W4) [NBP3-15386]

Immunocytochemistry/Immunofluorescence: MCM3 Antibody (9Z5W4) [NBP3-15386] - Immunofluorescence analysis of NIH-3T3 cells using MCM3 Rabbit mAb (NBP3-15386) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: MCM3 Antibody (9Z5W4) [NBP3-15386]

Immunohistochemistry-Paraffin: MCM3 Antibody (9Z5W4) [NBP3-15386]

Immunohistochemistry-Paraffin: MCM3 Antibody (9Z5W4) [NBP3-15386] - Immunohistochemistry of paraffin-embedded human liver cancer using MCM3 Rabbit mAb (NBP3-15386) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Western Blot: MCM3 Antibody (9Z5W4) [NBP3-15386]

Western Blot: MCM3 Antibody (9Z5W4) [NBP3-15386]

Western Blot: MCM3 Antibody (9Z5W4) [NBP3-15386] - Western blot analysis of extracts of various cell lines, using MCM3 Rabbit mAb (NBP3-15386) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: MCM3 Antibody (9Z5W4) [NBP3-15386]

Immunocytochemistry/ Immunofluorescence: MCM3 Antibody (9Z5W4) [NBP3-15386]

Immunocytochemistry/Immunofluorescence: MCM3 Antibody (9Z5W4) [NBP3-15386] - Immunofluorescence analysis of HeLa cells using MCM3 Rabbit mAb (NBP3-15386) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: MCM3 Antibody (9Z5W4) [NBP3-15386]

Immunohistochemistry-Paraffin: MCM3 Antibody (9Z5W4) [NBP3-15386]

Immunohistochemistry-Paraffin: MCM3 Antibody (9Z5W4) [NBP3-15386] - Immunohistochemistry of paraffin-embedded rat spleen using MCM3 Rabbit mAb (NBP3-15386) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunoprecipitation: MCM3 Antibody (9Z5W4) [NBP3-15386]

Immunoprecipitation: MCM3 Antibody (9Z5W4) [NBP3-15386]

Immunoprecipitation: MCM3 Antibody (9Z5W4) [NBP3-15386] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug MCM3 antibody (NBP3-15386). Western blot was performed from the immunoprecipitate using MCM3 antibody (NBP3-15386) at a dilition of 1:1000.
MCM3 Antibody (9Z5W4)

Immunocytochemistry/ Immunofluorescence: MCM3 Antibody (9Z5W4) [MCM3] -

Immunocytochemistry/ Immunofluorescence: MCM3 Antibody (9Z5W4) [MCM3] - Immunofluorescence analysis of NIH-3T3 cells using MCM3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for MCM3 Antibody (9Z5W4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

.5ug-4ug antibody for 200ug-400ug extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MCM3

MCM3 is encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.

Alternate Names

cervical cancer proto-oncogene 5, DNA polymerase alpha holoenzyme-associated protein P1, DNA replication factor MCM3, DNA replication licensing factor MCM3, EC 3.6.4.12, HCC5, hRlf beta subunit, MCM3 minichromosome maintenance deficient 3, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae), MGC1157, minichromosome maintenance complex component 3, minichromosome maintenance deficient (S. cerevisiae) 3, minichromosome maintenance deficient 3, P1.h, p102, P1-MCM3, replication licensing factor, beta subunit, RLF subunit beta, RLFB

Gene Symbol

MCM3

Additional MCM3 Products

Product Documents for MCM3 Antibody (9Z5W4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MCM3 Antibody (9Z5W4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MCM3 Antibody (9Z5W4)

There are currently no reviews for this product. Be the first to review MCM3 Antibody (9Z5W4) and earn rewards!

Have you used MCM3 Antibody (9Z5W4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...