MDH2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89539

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MDH2 Antibody - BSA Free

MDH2 Antibody - BSA Free Immunohistochemistry-Paraffin: MDH2 Antibody - BSA Free [NBP1-89539]

Immunohistochemistry-Paraffin: MDH2 Antibody - BSA Free [NBP1-89539]

Staining of human duodenum, fallopian tube, kidney and liver using Anti-MDH2 antibody NBP1-89539 (A) shows similar protein distribution across tissues to independent antibody NBP1-86036 (B).
MDH2 Antibody - BSA Free Immunohistochemistry-Paraffin: MDH2 Antibody - BSA Free [NBP1-89539]

Immunohistochemistry-Paraffin: MDH2 Antibody - BSA Free [NBP1-89539]

Staining of human kidney shows strong positivity in cytoplasm granular in cells in tubules.
MDH2 Antibody - BSA Free Immunohistochemistry-Paraffin: MDH2 Antibody - BSA Free [NBP1-89539]

Immunohistochemistry-Paraffin: MDH2 Antibody - BSA Free [NBP1-89539]

Staining of human duodenum shows strong positivity in cytoplasm granular in glandular cells.
MDH2 Antibody - BSA Free Immunohistochemistry-Paraffin: MDH2 Antibody - BSA Free [NBP1-89539]

Immunohistochemistry-Paraffin: MDH2 Antibody - BSA Free [NBP1-89539]

Staining of human liver shows strong positivity in cytoplasm granular in hepatocytes.
MDH2 Antibody - BSA Free Immunohistochemistry-Paraffin: MDH2 Antibody - BSA Free [NBP1-89539]

Immunohistochemistry-Paraffin: MDH2 Antibody - BSA Free [NBP1-89539]

Staining of human fallopian tube shows strong positivity in cytoplasm granular in glandular cells.
MDH2 Antibody - BSA Free Western Blot: MDH2 Antibody - BSA Free [NBP1-89539]

Western Blot: MDH2 Antibody - BSA Free [NBP1-89539]

Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-MDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Applications for MDH2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MDH2

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. [provided by RefSeq]

Long Name

Malate dehydrogenase, mitochondrial

Alternate Names

EC 1.1.1.37

Gene Symbol

MDH2

Additional MDH2 Products

Product Documents for MDH2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MDH2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MDH2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MDH2 Antibody - BSA Free and earn rewards!

Have you used MDH2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...