MEF2D Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85788

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Simple Western, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MEF2D Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MEF2D Antibody - BSA Free

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788]

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788]

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human kidney, liver, placenta and skeletal muscle using Anti-MEF2D antibody NBP1-85788 (A) shows similar protein distribution across tissues to independent antibody NBP1-85795 (B).
Immunocytochemistry/ Immunofluorescence: MEF2D Antibody [NBP1-85788]

Immunocytochemistry/ Immunofluorescence: MEF2D Antibody [NBP1-85788]

Immunocytochemistry/Immunofluorescence: MEF2D Antibody [NBP1-85788] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788]

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788]

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human kidney shows strong nuclear postivity in cells in glomeruli.
Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788]

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788]

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788]

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788]

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788]

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788]

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85788] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
ELISA: MEF2D Antibody [NBP1-85788]

ELISA: MEF2D Antibody [NBP1-85788]

ELISA: MEF2D Antibody [NBP1-85788] - Lysates from NIH3T3 and SVG-A cells assessed by ELISA, loading the indicated mass of total protein per well. Antibody was diluted 1:250, and used in conjunction with an HRP-conjugated secondary antibody. Signal was detected by luminescence. Image from verified customer review.
MEF2D Antibody - BSA Free Western Blot: MEF2D Antibody - BSA Free [NBP1-85788]

Western Blot: MEF2D Antibody - BSA Free [NBP1-85788]

Analysis in human cell line THP-1.
MEF2D Antibody - BSA Free Immunohistochemistry-Paraffin: MEF2D Antibody - BSA Free [NBP1-85788]

Immunohistochemistry-Paraffin: MEF2D Antibody - BSA Free [NBP1-85788]

Immunohistochemistry analysis in human skeletal muscle and liver tissues using HPA007114 antibody. Corresponding MEF2D RNA-seq data are presented for the same tissues.
MEF2D Antibody - BSA Free Western Blot: MEF2D Antibody - BSA Free [NBP1-85788]

Western Blot: MEF2D Antibody - BSA Free [NBP1-85788]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
MEF2D Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: MEF2D Antibody - BSA Free [NBP1-85788]

Chromatin Immunoprecipitation-exo-Seq: MEF2D Antibody - BSA Free [NBP1-85788]

ChIP-Exo-Seq composite graph for Anti-MEF2D (NBP1-85788) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for MEF2D Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

ELISA

Reactivity form a verified customer review.

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Simple Western

1:50 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. Com/resources/simple-western-antibody-database?term=NBP1-85788">Simple Western Antibody Database for Simple Western validation: Mouse Brain lysate as sample; separated by size; antibody dilution of 1:50 - 1:1000; matrix was 12-230 kDa; detected by Chemiluminescence.

Reviewed Applications

Read 2 reviews rated 4 using NBP1-85788 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MEF2D

Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific, growth factor- and stress-induced genes. Mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. Plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and/or growth factor-related transcription. Plays a critical role in the regulation of neuronal apoptosis

Alternate Names

DKFZp686I1536, MADS box transcription enhancer factor 2, polypeptide D (myocyte enhancerfactor 2D), MEF2D/DAZAP1 fusion, myocyte enhancer factor 2D, myocyte enhancer factor 2D/deleted in azoospermia associated protein 1 fusionprotein, myocyte-specific enhancer factor 2D

Gene Symbol

MEF2D

Additional MEF2D Products

Product Documents for MEF2D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MEF2D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MEF2D Antibody - BSA Free (2)

4 out of 5
2 Customer Ratings
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used MEF2D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • MEF2D Antibody
    Name: Anonymous
    Application: ELISA
    Sample Tested: SVG-A cells and NIH 3T3 cells
    Species: Human and Mouse
    Verified Customer | Posted 06/05/2018
    Lysates from NIH3T3 and SVG-A cells assessed by ELISA, loading the indicated mass of total protein per well. Antibody was diluted 1:250, and used in conjunction with an HRP-conjugated secondary antibody. Signal was detected by luminescence.
    MEF2D Antibody - BSA Free NBP1-85788
  • Name: Anonymous
    Application: Simple Western
    Sample Tested: mouse whole brain lysate
    Species: Mouse
    Verified Customer | Posted 03/25/2016
    MEF2D expression in mouse brain lysate
    MEF2D Antibody - BSA Free NBP1-85788

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies