MEKK1 Antibody (2F6) - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-47810

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2F6

Format

Azide and BSA Free
View all MEKK1 Primary Antibodies »

Product Specifications

Immunogen

Partial recombinant MEKK1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) (Uniprot: Q13233)

Localization

Cytoplasmic

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

1.0 mg/ml of antibody purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS WITHOUT BSA & azide. Also available at 200 ug/ml WITH BSA & azide (NBP2-44405).

Antibody with azide - store at 2 to 8C. Antibody without azide - store at -20 to -80C.

Scientific Data Images for MEKK1 Antibody (2F6) - Azide and BSA Free

Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810]

Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810]

Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Uterine Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810]

Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810]

Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Cervical Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810]

Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810]

Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Thyroid Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).

Applications for MEKK1 Antibody (2F6) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1-2 ug/ml
Application Notes
Immunohistochemistry (Formalin-fixed): 1-2ug/ml for 30 minutes at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris Buffer with 1mM EDTA, pH 9.0, for 45 min at 95C followed by cooling at RT for 20 minutes.
Optimal dilution for a specific application should be determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

10 mM PBS

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

1.0 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20 to -80C. Avoid freeze-thaw cycles.

Background: MEKK1

MEKKs (Mitogen activated protein kinase kinase kinases) are serine-threonine kinases that act as the first tier of cellular MAP kinase pathways by activation of MAP/ERK kinases, or MEKs. Many enzymes with MEKK activity have been identified, including MEKK1-4, Raf, MLK3, TAK, and DLK. MEKKs generally display little similarity outside of their catalytic kinase domains. MEKK1-4 are nearly 50% identical within their catalytic domains, and are known to regulate Erk, Jnk, and p38 MAP kinase pathways. MEKK2 and MEKK3 bind MEK5 via conserved PB1 domains, leading to downstream activation of Erk5.

Alternate Names

Map3k1, MAPK/ERK kinase kinase 1, MAPKKK1MAP/ERK kinase kinase 1, MEK kinase 1, MEKK1EC 2.7.11.25, MEKKMEKK 1, mitogen-activated protein kinase kinase kinase 1

Gene Symbol

MAP3K1

Additional MEKK1 Products

Product Documents for MEKK1 Antibody (2F6) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MEKK1 Antibody (2F6) - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MEKK1 Antibody (2F6) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MEKK1 Antibody (2F6) - Azide and BSA Free and earn rewards!

Have you used MEKK1 Antibody (2F6) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies