Melan-A/MART-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33535

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Melan-A/MART-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: RRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Melan-A/MART-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535]

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535]

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535] - Analysis in human skin and liver tissues using HPA048662 antibody. Corresponding MLANA RNA-seq data are presented for the same tissues
Western Blot: Melan-A/MART-1 Antibody [NBP2-33535]

Western Blot: Melan-A/MART-1 Antibody [NBP2-33535]

Western Blot: Melan-A/MART-1 Antibody [NBP2-33535] - Analysis in human cell lines SK-MEL-30 and PC-3 using anti-MLANA antibody. Corresponding MLANA RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535]

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535]

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535]

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535]

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535] - Staining of human skin shows strong cytoplasmic positivity in melanocytes.
Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535]

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535]

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535]

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535]

Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody [NBP2-33535] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Applications for Melan-A/MART-1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Simple Western

1:100

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Sk-Mel-28 lysate as sample; separated by size; antibody dilution of 1:100; observed molecular weight was 23 kDa; matrix was 12-230 kDa; detected by Chemiluminescence.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Melan-A/MART-1

MART-1 (Melanoma Antigen Recognized by T cells 1) or Melan-A1 is a newly identified melanocyte differentiation antigen recognized by autologous cytotoxic T lymphocytes. Seven other melanoma associated antigens recognized by autologous cytotoxic T cells include MAGE-1, MAGE-3, tyrosinase, gp100, gp75, BAGE-1, and GAGE-1. Subcellular fractionation shows that MART-1 is present in melanosomes and endoplasmic reticulum.

Alternate Names

Antigen LB39-AA, Antigen SK29-AA, MART-1, MelanA, MLANA

Gene Symbol

MLANA

UniProt

Q16655

Additional Melan-A/MART-1 Products

Product Documents for Melan-A/MART-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Melan-A/MART-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers

Customer Reviews for Melan-A/MART-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Melan-A/MART-1 Antibody - BSA Free and earn rewards!

Have you used Melan-A/MART-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies