Melanoma antigen family C2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34145

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Melanoma antigen family C2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Melanoma antigen family C2 Antibody [NBP2-34145]

Immunocytochemistry/ Immunofluorescence: Melanoma antigen family C2 Antibody [NBP2-34145]

Immunocytochemistry/Immunofluorescence: Melanoma antigen family C2 Antibody [NBP2-34145] - Staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145]

Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145]

Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145] - Staining in human testis and endometrium tissues using anti-MAGEC2 antibody. Corresponding MAGEC2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145]

Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145]

Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145]

Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145]

Immunohistochemistry-Paraffin: Melanoma antigen family C2 Antibody [NBP2-34145] - Staining of human testis shows high expression.

Applications for Melanoma antigen family C2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Melanoma antigen family C2

Melanoma antigen family C2 is related to members of the MAGEC gene family. It is not expressed in normal tissues, except for testis, and is expressed in tumors of various histological types. This gene and the MAGEC genes are clustered on chromosome Xq26-q27. [provided by RefSeq]

Alternate Names

Cancer/testis antigen 10, CT10MAGE-E1 antigen, HCA587MAGE-C2, hepatocellular cancer antigen 587, Hepatocellular carcinoma-associated antigen 587, MAGE-C2 antigen, MAGEE1MGC13377, melanoma antigen family C, 2, melanoma antigen, family E, 1, cancer/testis specific, melanoma-associated antigen C2

Gene Symbol

MAGEC2

UniProt

Additional Melanoma antigen family C2 Products

Product Documents for Melanoma antigen family C2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Melanoma antigen family C2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Melanoma antigen family C2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Melanoma antigen family C2 Antibody - BSA Free and earn rewards!

Have you used Melanoma antigen family C2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...