METTL14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38559

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human METTL14 (NP_066012.1).

Sequence:
MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for METTL14 Antibody - BSA Free

METTL14 Antibody

Immunohistochemistry: METTL14 Antibody [NBP3-38559] -

Immunohistochemistry: METTL14 Antibody [NBP3-38559] - Immunohistochemistry analysis of paraffin-embedded Human colon using METTL14 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
METTL14 Antibody

Immunohistochemistry: METTL14 Antibody [NBP3-38559] -

Immunohistochemistry: METTL14 Antibody [NBP3-38559] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using METTL14 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
METTL14 Antibody

Western Blot: METTL14 Antibody [NBP3-38559] -

Western Blot: METTL14 Antibody [NBP3-38559] - Western blot analysis of various lysates, using METTL14 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
METTL14 Antibody

Immunocytochemistry/ Immunofluorescence: METTL14 Antibody [NBP3-38559] -

Immunocytochemistry/ Immunofluorescence: METTL14 Antibody [NBP3-38559] - Immunofluorescence analysis of Human colon cancer tissue using METTL14 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.
METTL14 Antibody

Immunocytochemistry/ Immunofluorescence: METTL14 Antibody [NBP3-38559] -

Immunocytochemistry/ Immunofluorescence: METTL14 Antibody [NBP3-38559] - Immunofluorescence analysis of Mouse brain tissue using METTL14 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining. Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.

Applications for METTL14 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: METTL14

Probable methyltransferase

Long Name

Methyltransferase-Like Protein 14

Alternate Names

KIAA1627

Gene Symbol

METTL14

Additional METTL14 Products

Product Documents for METTL14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for METTL14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for METTL14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review METTL14 Antibody - BSA Free and earn rewards!

Have you used METTL14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...