MKP-1/DUSP1 Antibody (3A9) - Azide and BSA Free

Novus Biologicals | Catalog # H00001843-M05

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 3A9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

DUSP1 (NP_004408, 305 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC

Specificity

DUSP1 - dual specificity phosphatase 1 (3A9)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for MKP-1/DUSP1 Antibody (3A9) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: MKP-1/DUSP1 Antibody (3A9) [H00001843-M05]

Immunocytochemistry/ Immunofluorescence: MKP-1/DUSP1 Antibody (3A9) [H00001843-M05]

Immunocytochemistry/Immunofluorescence: MKP-1/DUSP1 Antibody (3A9) [H00001843-M05] - Analysis of monoclonal antibody to DUSP1 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: MKP-1/DUSP1 Antibody (3A9) [H00001843-M05] - Detection limit for recombinant GST tagged DUSP1 is 0.3 ng/ml as a capture antibody.

Applications for MKP-1/DUSP1 Antibody (3A9) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MKP-1

The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. [provided by RefSeq]

Long Name

MAP Kinase Phosphatase 1

Alternate Names

CL100, DUSP1, HVH1, MKP1, PTPN10

Entrez Gene IDs

1843 (Human)

Gene Symbol

DUSP1

Additional MKP-1 Products

Product Documents for MKP-1/DUSP1 Antibody (3A9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MKP-1/DUSP1 Antibody (3A9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MKP-1/DUSP1 Antibody (3A9) - Azide and BSA Free

Customer Reviews for MKP-1/DUSP1 Antibody (3A9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MKP-1/DUSP1 Antibody (3A9) - Azide and BSA Free and earn rewards!

Have you used MKP-1/DUSP1 Antibody (3A9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...