MMR/CD206/Mannose Receptor Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90020

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse, Porcine, Primate

Applications

Validated:

Western Blot, Flow Cytometry

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%), Mouse (84).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MMR/CD206/Mannose Receptor Antibody - BSA Free

MMR/CD206/Mannose Receptor Antibody - BSA Free Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody - BSA Free [NBP1-90020]

Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody - BSA Free [NBP1-90020]

Analysis in human lung and cerebral cortex tissues using NBP1-90020 antibody. Corresponding MRC1 RNA-seq data are presented for the same tissues.
MMR/CD206/Mannose Receptor Antibody - BSA Free Western Blot: MMR/CD206/Mannose Receptor Antibody - BSA Free [NBP1-90020]

Western Blot: MMR/CD206/Mannose Receptor Antibody - BSA Free [NBP1-90020]

Analysis in human liver tissue.

Applications for MMR/CD206/Mannose Receptor Antibody - BSA Free

Application
Recommended Usage

Flow Cytometry

Validated from a verified customer review

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 4 using NBP1-90020 in the following applications:

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MMR/CD206

The Mannose Receptor (MR), a member of the vertebrate C-type lectin family, is a pattern recognition receptor that is involved in both innate and adaptive immunity. The 180 kDa transmembrane protein consists of 5 domains: an amino-terminal cysteine-rich region, a fibronectin type II repeat, a series of eight tandem lectin-like carbohydrate recognition domains (responsible for the recognition of mannose and fucose), a transmembrane domain, and an intracellular carboxy-terminal tail.The structure is shared by the family of multi lectin mannose receptors: the phospholipase A2-receptor, DEC 205 and the novel C-type lectin receptor (mannose receptor X). The MR recognises a wide range of gram positive and gram negative bacteria, yeasts, parasites and mycobacteria. The MR has also been shown to bind and internalize tissue-type plasminogen activator. MR's are present on monocytes and dendritic cells (DC) and are presumed to play a role in innate and adaptive immunity, the latter via processing by DC. The expression of MR as observed in immunohistology is present on tissue macrophages, dendritic cells, a subpopulation of endothelial cells, Kupffer cells and sperm cells. The expression of MR on monocytes increases during culture and can be enhanced by cytokines such as IFN-gamma. Labeling of MR expressing monocytes/macrophages increases with prolonged incubation time probably due to internalization of the MR-antibody-complex. The antibody 15-2 prevents binding of glycoproteins including t-PA to MR. Detection of the MR with anti-MR monoclonal antibody 15-2 can substitute staining for mannose containing probes as labeled mannosylated BSA, a technique which is more cumbersome and less specific.

Long Name

Macrophage Mannose Receptor

Alternate Names

CD206, CLEC13D, MRC1

Gene Symbol

MRC1

Additional MMR/CD206 Products

Product Documents for MMR/CD206/Mannose Receptor Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MMR/CD206/Mannose Receptor Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MMR/CD206/Mannose Receptor Antibody - BSA Free

Customer Reviews for MMR/CD206/Mannose Receptor Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used MMR/CD206/Mannose Receptor Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • MMR/CD206/Mannose Receptor Antibody
    Name: Anonymous
    Application: Flow Cytometry
    Sample Tested: Liver
    Species: Mouse
    Verified Customer | Posted 08/09/2019
    MMR/CD206/Mannose Receptor Antibody - BSA Free NBP1-90020

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

FAQs for MMR/CD206/Mannose Receptor Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Is this product available for immunofluorescence?

    A: NBP1-90020 has only been validated in western blot and IHC on paraffin-embedded tissues. If you would be using fluorescence detection on tissues, it will work for your assay. If you want to use it to detect cells, then note the alternative antibody NBP1-95964 has been validated for immunocytochemistry and may be a better choice for you.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...