MPP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85014

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MPP3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SQDDPTWWQAKRVGDTNLRAGLIPSKGFQERRLSYRRAAGTLPSPQSLRKPPYDQPCDKETCDCEGYLKGHYVAGL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MPP3 Antibody - BSA Free

Western Blot: MPP3 Antibody [NBP1-85014]

Western Blot: MPP3 Antibody [NBP1-85014]

Western Blot: MPP3 Antibody [NBP1-85014] - Analysis in control (vector only transfected HEK293T lysate) and MPP3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MPP3 Antibody [NBP1-85014]

Immunocytochemistry/ Immunofluorescence: MPP3 Antibody [NBP1-85014]

Immunocytochemistry/Immunofluorescence: MPP3 Antibody [NBP1-85014] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014]

Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014]

Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014] - Staining of human liver shows no in hepatocytes as expected.
Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014]

Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014]

Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014]

Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014]

Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014] - Staining of human cerebellum shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014]

Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014]

Immunohistochemistry-Paraffin: MPP3 Antibody [NBP1-85014] - Staining of human kidney shows strong cytoplasmic positivity in cells in distal tubules.

Applications for MPP3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MPP3

MPP3 product is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. This protein contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in signal transduction. Alternatively spliced transcript variants have been identified. One transcript variant is experimentally supported, but it doesn't encode a protein.

Alternate Names

Discs large homolog 3, discs, large homolog 3, DLG3MAGUK p55 subfamily member 3, membrane protein palmitoylated 3, membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3), Protein MPP3

Gene Symbol

MPP3

Additional MPP3 Products

Product Documents for MPP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MPP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MPP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MPP3 Antibody - BSA Free and earn rewards!

Have you used MPP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies