MRPL51 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88567

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Flow Cytometry, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPL51 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MRPL51 Antibody [NBP1-88567]

Immunocytochemistry/ Immunofluorescence: MRPL51 Antibody [NBP1-88567]

Immunocytochemistry/Immunofluorescence: MRPL51 Antibody [NBP1-88567] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
MRPL51 Antibody - BSA Free Western Blot: MRPL51 Antibody - BSA Free [NBP1-88567]

Western Blot: MRPL51 Antibody - BSA Free [NBP1-88567]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
MRPL51 Antibody - BSA Free Immunohistochemistry-Paraffin: MRPL51 Antibody [NBP1-88567]

Immunohistochemistry-Paraffin: MRPL51 Antibody [NBP1-88567]

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
MRPL51 Antibody - BSA Free Immunohistochemistry-Paraffin: MRPL51 Antibody [NBP1-88567]

Immunohistochemistry-Paraffin: MRPL51 Antibody [NBP1-88567]

Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
MRPL51 Antibody - BSA Free Immunohistochemistry-Paraffin: MRPL51 Antibody [NBP1-88567]

Immunohistochemistry-Paraffin: MRPL51 Antibody [NBP1-88567]

Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
MRPL51 Antibody - BSA Free Immunohistochemistry-Paraffin: MRPL51 Antibody [NBP1-88567]

Immunohistochemistry-Paraffin: MRPL51 Antibody [NBP1-88567]

Staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.

Applications for MRPL51 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. Use in KD, WB, Flow reported in scientifc publication ( PMID: 32618081).

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPL51

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within themitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. Theyhave an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed.Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA.Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes inbiochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.Pseudogenes corresponding to this gene are found on chromosomes 4p and 21q. (provided by RefSeq)

Alternate Names

bMRP64bMRP-64, HSPC241,39S ribosomal protein L51, mitochondrial, L51mt, mitochondrial ribosomal protein 64, mitochondrial ribosomal protein bMRP64, mitochondrial ribosomal protein L51, MRP64CDA09, MRP-L51

Gene Symbol

MRPL51

Additional MRPL51 Products

Product Documents for MRPL51 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPL51 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MRPL51 Antibody - BSA Free

Customer Reviews for MRPL51 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPL51 Antibody - BSA Free and earn rewards!

Have you used MRPL51 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...