MRPS14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13622

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: YADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRATW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPS14 Antibody - BSA Free

Western Blot: MRPS14 Antibody [NBP2-13622]

Western Blot: MRPS14 Antibody [NBP2-13622]

Western Blot: MRPS14 Antibody [NBP2-13622] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: MRPS14 Antibody [NBP2-13622]

Immunocytochemistry/ Immunofluorescence: MRPS14 Antibody [NBP2-13622]

Immunocytochemistry/Immunofluorescence: MRPS14 Antibody [NBP2-13622] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear membrane & mitochondria.
Immunohistochemistry-Paraffin: MRPS14 Antibody [NBP2-13622]

Immunohistochemistry-Paraffin: MRPS14 Antibody [NBP2-13622]

Immunohistochemistry-Paraffin: MRPS14 Antibody [NBP2-13622] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
MRPS14 Antibody - BSA Free Immunohistochemistry: MRPS14 Antibody - BSA Free [NBP2-13622]

Immunohistochemistry: MRPS14 Antibody - BSA Free [NBP2-13622]

Staining of human Pancreas shows moderate granular cytoplasmic positivity in islets of Langerhans and exocrine glandular cells.
MRPS14 Antibody - BSA Free Immunohistochemistry: MRPS14 Antibody - BSA Free [NBP2-13622]

Immunohistochemistry: MRPS14 Antibody - BSA Free [NBP2-13622]

Staining of human Duodenum shows strong granular cytoplasmic positivity in glandular cells.
MRPS14 Antibody - BSA Free Immunohistochemistry: MRPS14 Antibody - BSA Free [NBP2-13622]

Immunohistochemistry: MRPS14 Antibody - BSA Free [NBP2-13622]

Staining of human Heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
MRPS14 Antibody - BSA Free Immunohistochemistry: MRPS14 Antibody - BSA Free [NBP2-13622]

Immunohistochemistry: MRPS14 Antibody - BSA Free [NBP2-13622]

Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.
MRPS14 Antibody - BSA Free Western Blot: MRPS14 Antibody - BSA Free [NBP2-13622]

Western Blot: MRPS14 Antibody - BSA Free [NBP2-13622]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4

Applications for MRPS14 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPS14

MRPS14, or Mitochondrial Ribosomal Protein S14, consists of a 128 amino acid isoform that is 15 kDa, and is a portion of the 28S mitochondrial ribosome subunit that aids in protein synthesis. Research is not currently being conducted on the relationship between MRPS14 and any diseases or disorders. MRPS14 interacts with ICT1, DDX56, USP42, MAP1LC3A, and MRPS2.

Alternate Names

DJ262D12.2, HSMRPS14, mitochondrial 28S ribosomal protein S14, mitochondrial ribosomal protein S14,28S ribosomal protein S14, mitochondrial, MRP-S14, S14mt

Gene Symbol

MRPS14

Additional MRPS14 Products

Product Documents for MRPS14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPS14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPS14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPS14 Antibody - BSA Free and earn rewards!

Have you used MRPS14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...