MRPS26 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92141

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EVLQLQEEVKNFITRENLEARVEAALDSRKNYNWAITREGLVVRPQRRDS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPS26 Antibody - BSA Free

Western Blot: MRPS26 Antibody [NBP1-92141]

Western Blot: MRPS26 Antibody [NBP1-92141]

Western Blot: MRPS26 Antibody [NBP1-92141] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: MRPS26 Antibody [NBP1-92141]

Immunocytochemistry/ Immunofluorescence: MRPS26 Antibody [NBP1-92141]

Immunocytochemistry/Immunofluorescence: MRPS26 Antibody [NBP1-92141] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: MRPS26 Antibody [NBP1-92141]

Immunohistochemistry-Paraffin: MRPS26 Antibody [NBP1-92141]

Immunohistochemistry-Paraffin: MRPS26 Antibody [NBP1-92141] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
MRPS26 Antibody - BSA Free Immunohistochemistry: MRPS26 Antibody - BSA Free [NBP1-92141]

Immunohistochemistry: MRPS26 Antibody - BSA Free [NBP1-92141]

Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
MRPS26 Antibody - BSA Free Western Blot: MRPS26 Antibody - BSA Free [NBP1-92141]

Western Blot: MRPS26 Antibody - BSA Free [NBP1-92141]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4

Applications for MRPS26 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPS26

MRPS26, also known as Mitochondrial Ribosomal Protein S26, consists of a 205 amino acid isoform that is 24 kDa, and is involved in protein synthesis, though its specific function within the process is unknown. Current research is currently being conducted on the between MRPS26 and a variety of diseases and disorders, including Dubin-Johnson syndrome, gout, and breast cancer. MRPS26 has been linked to the DNA damage response and the peptide biosynthetic process, through which it interacts with several proteins, such as ICT1, PPP2CA, USP42, LMNA, and KBTBD7.

Alternate Names

C20orf193, dJ534B8.3, GI008,28S ribosomal protein S13, mitochondrial, mitochondrial ribosomal protein S26, MRP-S13MRPS13, MRP-S26chromosome 20 open reading frame 193, NY-BR-87, RPMS1328S ribosomal protein S26, mitochondrial, S13mt, S26mt, serologically defined breast cancer antigen NY-BR-87

Gene Symbol

MRPS26

Additional MRPS26 Products

Product Documents for MRPS26 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPS26 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPS26 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPS26 Antibody - BSA Free and earn rewards!

Have you used MRPS26 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...