MRPS27 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35180

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MRPS27 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 255-414 of human MRPS27 (NP_055899.2).

Sequence:
YLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MRPS27 Antibody - BSA Free

MRPS27 Antibody

Immunocytochemistry/ Immunofluorescence: MRPS27 Antibody [NBP3-35180] -

Immunocytochemistry/ Immunofluorescence: MRPS27 Antibody [NBP3-35180] - Immunofluorescence analysis of L929 cells using MRPS27 Rabbit pAb at dilution of 100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
MRPS27 Antibody

Western Blot: MRPS27 Antibody [NBP3-35180] -

Western Blot: MRPS27 Antibody [NBP3-35180] - Western blot analysis of various lysates using MRPS27 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
MRPS27 Antibody

Immunocytochemistry/ Immunofluorescence: MRPS27 Antibody [NBP3-35180] -

Immunocytochemistry/ Immunofluorescence: MRPS27 Antibody [NBP3-35180] - Immunofluorescence analysis of U-2 OS cells using MRPS27 Rabbit pAb at dilution of 100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for MRPS27 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MRPS27

MRPS27, or Mitochondrial Ribosomal Protein S27, consists of a 414 amino acid isoform that is 48 kDa, and is involved in the manufacture of proteins as a portion of the small 28S mitochondrial ribosomal subunit. MRPS27 is not currently involved in any disease research. The protein is not linked to any pathways, but does interact with several other proteins, including YWHAZ, YWHAQ, HNRNPA1, ICT1, and DHX30.

Alternate Names

FLJ21764, KIAA0264FLJ23348, mitochondrial, mitochondrial ribosomal protein S27, MRP-S27

Gene Symbol

MRPS27

Additional MRPS27 Products

Product Documents for MRPS27 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MRPS27 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPS27 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPS27 Antibody - BSA Free and earn rewards!

Have you used MRPS27 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies