MST3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87833

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MST3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MST3 Antibody - BSA Free

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833]

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833]

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human liver, skin, small intestine and testis using Anti-STK24 antibody NBP1-87833 (A) shows similar protein distribution across tissues to independent antibody NBP1-87834 (B).
Western Blot: MST3 Antibody [NBP1-87833]

Western Blot: MST3 Antibody [NBP1-87833]

Western Blot: MST3 Antibody [NBP1-87833] - Analysis using Anti-STK24 antibody NBP1-87833 (A) shows similar pattern to independent antibody NBP1-87834 (B).
Immunocytochemistry/ Immunofluorescence: MST3 Antibody [NBP1-87833]

Immunocytochemistry/ Immunofluorescence: MST3 Antibody [NBP1-87833]

Immunocytochemistry/Immunofluorescence: MST3 Antibody [NBP1-87833] - Staining of human cell line A-431 shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833]

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833]

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Western Blot: MST3 Antibody [NBP1-87833]

Western Blot: MST3 Antibody [NBP1-87833]

Western Blot: MST3 Antibody [NBP1-87833] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833]

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833]

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833]

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833]

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833]

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833]

Immunohistochemistry-Paraffin: MST3 Antibody [NBP1-87833] - Staining of human liver shows very weak positivity in hepatocytes as expected.
ELISA: MST3 Antibody [NBP1-87833]

ELISA: MST3 Antibody [NBP1-87833]

ELISA: MST3 Antibody [NBP1-87833] - MST-3 levels in SH-SY5Y cell lysates. ELISA image added from a verified customer review

Applications for MST3 Antibody - BSA Free

Application
Recommended Usage

ELISA

Validated from a verified customer review

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP1-87833 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MST3

The growth of axons is fundamental to the development and repair of brain circuitry. It has been shown that Mst3, a neuron-specific homolog of the yeast kinase Ste20, is critical for axon outgrowth. Mst3 is activated in response to trophic factors, and suppressing its expression or its function blocks axon outgrowth (1). Mst3 has been recently demonstrated to undergo a caspase-mediated cleavage during apoptosis. The proteolytic cleavage of the C-terminus of Mst3 caused nuclear translocation of its kinase domain. Mst3 contains both nuclear localization sequence (NLS) and NES signals, which may cooperate to control the subcellular distribution of Mst3 (2). In situ hybridization of rat brain sections indicated that MST3b is widely expressed in different brain regions, with especially high expression in hippocampus and cerebral cortex. When expressed in human embryonic kidney 293 (HEK293) cells, MST3b effectively phosphorylated myelin basic protein, as well as undergoing autophosphorylation (3)

Alternate Names

EC 2.7.11, EC 2.7.11.1, Mammalian STE20-like protein kinase 3, MST-3, MST3serine/threonine kinase 24 (Ste20, yeast homolog), serine/threonine kinase 24, serine/threonine-protein kinase 24, STE20, STE20-like kinase 3, STE20-like kinase MST3, sterile 20-like kinase 3, STK3yeast)

Gene Symbol

STK24

Additional MST3 Products

Product Documents for MST3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MST3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MST3 Antibody - BSA Free

Customer Reviews for MST3 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used MST3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • MST3 Antibody
    Name: Russ Tas
    Application: ELISA
    Sample Tested: SH-SY5Y cell lsyate
    Species: Human
    Verified Customer | Posted 11/12/2021
    MST-3 levels in SH-SY5Y cell lysates
    MST3 Antibody - BSA Free NBP1-87833
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies