MST4 Antibody (7H4) - Azide and BSA Free

Novus Biologicals | Catalog # H00051765-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 7H4

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

RP6-213H19.1 (NP_057626, 331 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADES

Localization

Cytoplasmic and Golgi Apparatus

Specificity

RP6-213H19.1 - Mst3 and SOK1-related kinase

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for MST4 Antibody (7H4) - Azide and BSA Free

Western Blot: MST4 Antibody (7H4) [H00051765-M02]

Western Blot: MST4 Antibody (7H4) [H00051765-M02]

Western Blot: MST4 Antibody (7H4) [H00051765-M02] - RP6-213H19 1 monoclonal antibody (M02), clone 7H4 Analysis of RP6-213H19 1 expression in HeLa.
Immunocytochemistry/ Immunofluorescence: MST4 Antibody (7H4) [H00051765-M02]

Immunocytochemistry/ Immunofluorescence: MST4 Antibody (7H4) [H00051765-M02]

Immunocytochemistry/Immunofluorescence: MST4 Antibody (7H4) [H00051765-M02] - Analysis of monoclonal antibody to RP6-213H19.1 on HeLa cell. Antibody concentration 20 ug/ml.
Western Blot: MST4 Antibody (7H4) [H00051765-M02]

Western Blot: MST4 Antibody (7H4) [H00051765-M02]

Western Blot: MST4 Antibody (7H4) [H00051765-M02] - RP6-213H19.1 monoclonal antibody (M02), clone 7H4. Analysis of RP6-213H19.1 expression in PC-12.
Sandwich ELISA: MST4 Antibody (7H4) [H00051765-M02] - Detection limit for recombinant GST tagged RP6-213H19.1 is approximately 0.1ng/ml as a capture antibody.

Applications for MST4 Antibody (7H4) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: MST4

The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerization. The protein kinase localizes to the Golgi apparatus and is specifically activated by binding to the Golgi matrix protein GM130. It is also cleaved by caspase-3 in vitro, and may function in the apoptotic pathway. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Alternate Names

EC 2.7.11, EC 2.7.11.1, Mammalian STE20-like protein kinase 4, mammalian sterile 20-like 4, MASK, Mst3 and SOK1-related kinase, MST-4, serine/threonine protein kinase MASK, serine/threonine protein kinase MST4, Serine/threonine-protein kinase MASK, serine/threonine-protein kinase MST4, STE20-like kinase MST4

Entrez Gene IDs

51765 (Human)

Gene Symbol

STK26

OMIM

300547 (Human)

Additional MST4 Products

Product Documents for MST4 Antibody (7H4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MST4 Antibody (7H4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MST4 Antibody (7H4) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MST4 Antibody (7H4) - Azide and BSA Free and earn rewards!

Have you used MST4 Antibody (7H4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...