MT-CO2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93084

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 40-100 of human MT-CO2 (YP_003024029.1). YALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MT-CO2 Antibody - Azide and BSA Free

MT-CO2 Antibody - Azide and BSA Free

Western Blot: MT-CO2 Antibody - Azide and BSA Free [NBP2-93084] -

Western Blot: MT-CO2 Antibody - Azide and BSA Free [NBP2-93084] - Western blot analysis of lysates from HeLa cells, using MT-CO2 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
MT-CO2 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: MT-CO2 Antibody - Azide and BSA Free [NBP2-93084] -

Immunocytochemistry/ Immunofluorescence: MT-CO2 Antibody - Azide and BSA Free [NBP2-93084] - Immunofluorescence analysis of HepG2 cells using MT-CO2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
MT-CO2 Antibody - Azide and BSA Free

Immunohistochemistry: MT-CO2 Antibody - Azide and BSA Free [NBP2-93084] -

Immunohistochemistry: MT-CO2 Antibody - Azide and BSA Free [NBP2-93084] - Immunohistochemistry analysis of paraffin-embedded Human colon using MT-CO2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
MT-CO2 Antibody - Azide and BSA Free

Immunohistochemistry: MT-CO2 Antibody - Azide and BSA Free [NBP2-93084] -

Immunohistochemistry: MT-CO2 Antibody - Azide and BSA Free [NBP2-93084] - Immunohistochemistry analysis of paraffin-embedded Rat colon using MT-CO2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for MT-CO2 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MT-CO2

Alternate Names

COII, COX2, COXII, Cytochrome C Oxidase II, Cytochrome C Oxidase Polypeptide II, Cytochrome C Oxidase Subunit II, EC 1.9.3.1, Mitochondrially Encoded Cytochrome C Oxidase II, MTCO2

Gene Symbol

COX2

Additional MT-CO2 Products

Product Documents for MT-CO2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MT-CO2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for MT-CO2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MT-CO2 Antibody - Azide and BSA Free and earn rewards!

Have you used MT-CO2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...