MT-ND1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35818

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 151-251 of human MT-ND1 (YP_003024026.1).

Sequence:
LLSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDAL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MT-ND1 Antibody - BSA Free

MT-ND1 Antibody

Western Blot: MT-ND1 Antibody [NBP3-35818] -

Western Blot: MT-ND1 Antibody [NBP3-35818] - Western blot analysis of various lysates using MT-ND1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 120s.
MT-ND1 Antibody

Immunocytochemistry/ Immunofluorescence: MT-ND1 Antibody [NBP3-35818] -

Immunocytochemistry/ Immunofluorescence: MT-ND1 Antibody [NBP3-35818] - Immunofluorescence analysis of L929 cells using MT-ND1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for MT-ND1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MT-ND1

NADH:ubiquinone oxidoreductase (complex I) is an extremely complicated multiprotein complex located in the inner mitochondrial membrane. Human complex I is important for energy metabolism because its main function is to transport electrons from NADH to ubiquinone, which is accompanied by translocation of protons from the mitochondrial matrix to the intermembrane space. Human complex I appears to consist of 41 subunits. A small number of complex I subunits are the products of mitochondrial genes (subunits 1-7),while the remainder are nuclear encoded and imported from the cytoplasm. NADH dehydrogenase subunit 1 (ND1) binds rotenone and rotenone analogs and might be involved in electron transfer to ubiquinone. Mutations in the ND1 gene may be implicated in several disorders, including Leber hereditary optic neuropathy, Alzheimer's disease and Parkinson disease.

Alternate Names

EC 1.6.5.3, mitochondrially encoded NADH dehydrogenase 1, MTND1, NAD1, NADH dehydrogenase subunit 1, NADH dehydrogenase, subunit 1 (complex I), NADH1, ND1NADH dehydrogenase 1

Gene Symbol

ND1

Additional MT-ND1 Products

Product Documents for MT-ND1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MT-ND1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MT-ND1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MT-ND1 Antibody - BSA Free and earn rewards!

Have you used MT-ND1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...