MT-ND4L Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-05239

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all MT-ND4L Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 40 to the C-terminus of human MT-ND4L (AXQ02532.1). LFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MT-ND4L Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: MT-ND4L Antibody - Azide and BSA Free [NBP3-05239]

Immunocytochemistry/ Immunofluorescence: MT-ND4L Antibody - Azide and BSA Free [NBP3-05239]

Immunocytochemistry/Immunofluorescence: MT-ND4L Antibody [NBP3-05239] - Analysis of L929 cells using MT-ND4L antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: MT-ND4L Antibody - Azide and BSA Free [NBP3-05239]

Immunocytochemistry/ Immunofluorescence: MT-ND4L Antibody - Azide and BSA Free [NBP3-05239]

Immunocytochemistry/Immunofluorescence: MT-ND4L Antibody [NBP3-05239] - Analysis of C6 cells using MT-ND4L antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
MT-ND4L Antibody - Azide and BSA Free

Western Blot:MT-ND4L Antibody [NBP3-05239] -

Western Blot:MT-ND4L Antibody [NBP3-05239] - Analysis of various lysates, using MT-ND4L Rabbit pAb at 1:600 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.

Applications for MT-ND4L Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MT-ND4L

Alternate Names

Complex I ND4L Subunit, EC 1.6.5.3, Mitochondrially Encoded NADH Dehydrogenase 4L, Mitochondrially Encoded NADH:Ubiquinone, MTND4L, NADH Dehydrogenase 4L, NADH Dehydrogenase, Subunit 4L (Complex I), NADH4L, NADH-Ubiquinone Oxidoreductase Chain 4L, ND4L, Oxidoreductase Core Subunit 4L

Gene Symbol

ND4L

Additional MT-ND4L Products

Product Documents for MT-ND4L Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MT-ND4L Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for MT-ND4L Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MT-ND4L Antibody - Azide and BSA Free and earn rewards!

Have you used MT-ND4L Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies