mu Crystallin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55172

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all mu Crystallin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for mu Crystallin Antibody - BSA Free

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172]

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172]

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Analysis in human cererbral cortex and pancreas tissues. Corresponding CRYM RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172]

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172]

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human cerebral cortex, kidney, pancreas and prostate using Anti-mu Crystallin antibody NBP2-55172 (A) shows similar protein distribution across tissues to independent antibody NBP1-85241 (B).
Immunocytochemistry/ Immunofluorescence: mu Crystallin Antibody [NBP2-55172]

Immunocytochemistry/ Immunofluorescence: mu Crystallin Antibody [NBP2-55172]

Immunocytochemistry/Immunofluorescence: mu Crystallin Antibody [NBP2-55172] - Staining of human cell line SH-SY5Y shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172]

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172]

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172]

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172]

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172]

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172]

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human pancreas shows low postivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172]

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172]

Immunohistochemistry-Paraffin: mu Crystallin Antibody [NBP2-55172] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.

Applications for mu Crystallin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: mu Crystallin

Alternate Names

crystallin, mu, DFNA40NADP-regulated thyroid-hormone binding protein, mu-crystallin homolog, NADP-regulated thyroid-hormone-binding protein, THBP

Gene Symbol

CRYM

Additional mu Crystallin Products

Product Documents for mu Crystallin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for mu Crystallin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for mu Crystallin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review mu Crystallin Antibody - BSA Free and earn rewards!

Have you used mu Crystallin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies