Muscleblind-like 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55165

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (97%), Rat (99%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, In Situ Hybridization

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Muscleblind-like 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Muscleblind-like 1 Antibody - BSA Free

Western Blot: Muscleblind-like 1 Antibody [NBP2-55165]

Western Blot: Muscleblind-like 1 Antibody [NBP2-55165]

Western Blot: Muscleblind-like 1 Antibody [NBP2-55165] - Analysis in human cell line THP-1.
Immunocytochemistry/ Immunofluorescence: Muscleblind-like 1 Antibody [NBP2-55165]

Immunocytochemistry/ Immunofluorescence: Muscleblind-like 1 Antibody [NBP2-55165]

Immunocytochemistry/Immunofluorescence: Muscleblind-like 1 Antibody [NBP2-55165] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165]

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165]

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165] - Staining of human tonsil shows moderate nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165]

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165]

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165] - Staining of human prostate shows moderate nuclear positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165]

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165]

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165]

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165]

Immunohistochemistry-Paraffin: Muscleblind-like 1 Antibody [NBP2-55165] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.

Applications for Muscleblind-like 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Muscleblind-like 1

Several important human diseases are associated with expansion of polynucleotide sequences, in most cases trinucleotide repeats. Myotonic dystrophy (DM1) is one of these diseases, and is associated with increases in the number of CTG repeats in the UTR of the gene encoding myotonin (a.k.a. DM Kinase, DMK or myotonin-Protein Kinase), a ser/thr kinase expressed specifically in muscle. Mammalian genomes contain three muscleblind-like proteins, generally referred to as MBNL1, MBNL2 and MBNL3, and all three were found to associate with long double stranded CUG RNA repeats, thus, being triplet repeat expansion dsRNA-binding proteins.

Alternate Names

DKFZp686P06174, EXP40, EXP42, EXPKIAA0428EXP35, MBNL, muscleblind (Drosophila)-like, muscleblind-like (Drosophila), muscleblind-like protein 1, Triplet-expansion RNA-binding protein

Gene Symbol

MBNL1

Additional Muscleblind-like 1 Products

Product Documents for Muscleblind-like 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Muscleblind-like 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Muscleblind-like 1 Antibody - BSA Free

Customer Reviews for Muscleblind-like 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Muscleblind-like 1 Antibody - BSA Free and earn rewards!

Have you used Muscleblind-like 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies