N-PAC Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38618

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for N-PAC Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: N-PAC Antibody [NBP2-38618]

Immunocytochemistry/ Immunofluorescence: N-PAC Antibody [NBP2-38618]

Immunocytochemistry/Immunofluorescence: N-PAC Antibody [NBP2-38618] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618] - Staining of human testis.
Immunohistochemistry: N-PAC Antibody [NBP2-38618]

Immunohistochemistry: N-PAC Antibody [NBP2-38618]

Immunohistochemistry: N-PAC Antibody [NBP2-38618] - Staining of human kidney shows strong nuclear and cytoplasmic positivity in cells in tubules and cells in glomeruli.
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618] - Staining of human cerebral cortex, colon, kidney and testis using Anti-GLYR1 antibody NBP2-38618 (A) shows similar protein distribution across tissues to independent antibody NBP2-38576 (B).
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618] - Staining of human kidney.
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]

Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618] - Staining of human colon.
N-PAC Antibody - BSA Free Chromatin Immunoprecipitation ChIP: N-PAC Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: N-PAC Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-N-PAC tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for N-PAC Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: N-PAC

N-PAC may have oxidoreductase activity. Regulates p38 MAP kinase activity by mediating stress activation ofp38alpha/MAPK14 and specifically regulating MAPK14 signaling. Indirectly promotes phosphorylation of MAPK14 andactivation of ATF2. The phosphorylation of

Alternate Names

BM045, Cytokine-like nuclear factor N-PAC, Glyoxylate reductase 1 homolog, glyoxylate reductase 1 homolog (Arabidopsis), HIBDLnuclear protein 60 kDa, NP603-hydroxyisobutyrate dehydrogenase-like protein, N-PAC, nuclear protein 60kDa, Nuclear protein NP60, Nuclear protein of 60 kDa, putative oxidoreductase GLYR1

Gene Symbol

GLYR1

UniProt

Additional N-PAC Products

Product Documents for N-PAC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for N-PAC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for N-PAC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review N-PAC Antibody - BSA Free and earn rewards!

Have you used N-PAC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...