N-PAC Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-38618
![Immunocytochemistry/ Immunofluorescence: N-PAC Antibody [NBP2-38618]](https://resources.rndsystems.com/images/products/N-PAC-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38618-img0003.jpg "Immunocytochemistry/ Immunofluorescence: N-PAC Antibody [NBP2-38618]")
Loading...
Key Product Details
Validated by
Independent Antibodies
Species Reactivity
Validated:
Human
Predicted:
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIV
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for N-PAC Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: N-PAC Antibody [NBP2-38618]
Immunocytochemistry/Immunofluorescence: N-PAC Antibody [NBP2-38618] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.![Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]](https://resources.rndsystems.com/images/products/N-PAC-Antibody-Immunohistochemistry-Paraffin-NBP2-38618-img0007.jpg "Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]")
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618] - Staining of human testis.![Immunohistochemistry: N-PAC Antibody [NBP2-38618]](https://resources.rndsystems.com/images/products/N-PAC-Antibody-Immunohistochemistry-NBP2-38618-img0002.jpg "Immunohistochemistry: N-PAC Antibody [NBP2-38618]")
Immunohistochemistry: N-PAC Antibody [NBP2-38618]
Immunohistochemistry: N-PAC Antibody [NBP2-38618] - Staining of human kidney shows strong nuclear and cytoplasmic positivity in cells in tubules and cells in glomeruli.![Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]](https://resources.rndsystems.com/images/products/N-PAC-Antibody-Immunohistochemistry-Paraffin-NBP2-38618-img0004.jpg "Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]")
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618] - Staining of human cerebral cortex, colon, kidney and testis using Anti-GLYR1 antibody NBP2-38618 (A) shows similar protein distribution across tissues to independent antibody NBP2-38576 (B).![Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]](https://resources.rndsystems.com/images/products/N-PAC-Antibody-Immunohistochemistry-Paraffin-NBP2-38618-img0005.jpg "Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]")
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618] - Staining of human kidney.![Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]](https://resources.rndsystems.com/images/products/N-PAC-Antibody-Immunohistochemistry-Paraffin-NBP2-38618-img0006.jpg "Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]")
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618] - Staining of human cerebral cortex.![Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]](https://resources.rndsystems.com/images/products/N-PAC-Antibody-Immunohistochemistry-Paraffin-NBP2-38618-img0008.jpg "Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]")
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618]
Immunohistochemistry-Paraffin: N-PAC Antibody [NBP2-38618] - Staining of human colon.
Chromatin Immunoprecipitation ChIP: N-PAC Antibody - BSA Free
ChIP-Exo-Seq composite graph for Anti-N-PAC tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.Applications for N-PAC Antibody - BSA Free
Application
Recommended Usage
Chromatin Immunoprecipitation-exo-Seq
1-10ug per reaction
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: N-PAC
Alternate Names
BM045, Cytokine-like nuclear factor N-PAC, Glyoxylate reductase 1 homolog, glyoxylate reductase 1 homolog (Arabidopsis), HIBDLnuclear protein 60 kDa, NP603-hydroxyisobutyrate dehydrogenase-like protein, N-PAC, nuclear protein 60kDa, Nuclear protein NP60, Nuclear protein of 60 kDa, putative oxidoreductase GLYR1
Gene Symbol
GLYR1
UniProt
Additional N-PAC Products
Product Documents for N-PAC Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for N-PAC Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for N-PAC Antibody - BSA Free
There are currently no reviews for this product. Be the first to review N-PAC Antibody - BSA Free and earn rewards!
Have you used N-PAC Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...