NCCRP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13642

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: RNLLRSPNPEGINIYEPAPPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NCCRP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NCCRP1 Antibody [NBP2-13642]

Immunocytochemistry/ Immunofluorescence: NCCRP1 Antibody [NBP2-13642]

Immunocytochemistry/Immunofluorescence: NCCRP1 Antibody [NBP2-13642] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642]

Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642]

Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642]

Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642]

Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642] - Staining of human skin shows moderate positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642]

Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642]

Immunohistochemistry-Paraffin: NCCRP1 Antibody [NBP2-13642] - Staining of human cervix, uterine shows positivity in squamous epithelial cells.
NCCRP1 Antibody - BSA Free Immunohistochemistry: NCCRP1 Antibody - BSA Free [NBP2-13642]

Immunohistochemistry: NCCRP1 Antibody - BSA Free [NBP2-13642]

Staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.
NCCRP1 Antibody - BSA Free Immunohistochemistry: NCCRP1 Antibody - BSA Free [NBP2-13642]

Immunohistochemistry: NCCRP1 Antibody - BSA Free [NBP2-13642]

Staining of human skin shows moderate positivity in squamous epithelial cells.
NCCRP1 Antibody - BSA Free Immunohistochemistry: NCCRP1 Antibody - BSA Free [NBP2-13642]

Immunohistochemistry: NCCRP1 Antibody - BSA Free [NBP2-13642]

Staining of human liver shows no positivity in hepatocytes as expected.
NCCRP1 Antibody - BSA Free Immunohistochemistry: NCCRP1 Antibody - BSA Free [NBP2-13642]

Immunohistochemistry: NCCRP1 Antibody - BSA Free [NBP2-13642]

Staining of human cervix, uterine shows positivity in squamous epithelial cells.

Applications for NCCRP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NCCRP1

Non-specific cytotoxic cells (NCCs) in teleosts and their evolutionary homologue are a subpopulation of lymphocytes with properties that distinguish them from either B- or T-cells. One such property is that NCC/natural killer (NK)/lymphokine activated killer (LAK) cells express spontaneous, non-major histocompatibility complex restricted cytotoxic activity. NCC and LAK lyse a variety of transformed murine and human B-cell, T-cell and myeloid targets. A 32 kDa membrane protein [non-specific cytotoxic cell receptor protein (NCCRP-1)] expressed by NCC and certain mammalian NK/LAK cells mediates this cytotoxicity. NCCRP-1 is evolutionarily conserved and is found in species ranging from marine and freshwater teleosts to higher mammals.

Alternate Names

LOC342897, NCCRP-1, nonspecific cytotoxic cell receptor protein 1 homolog, non-specific cytotoxic cell receptor protein 1 homolog, non-specific cytotoxic cell receptor protein 1 homolog (zebrafish)

Gene Symbol

NCCRP1

Additional NCCRP1 Products

Product Documents for NCCRP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NCCRP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NCCRP1 Antibody - BSA Free

Customer Reviews for NCCRP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NCCRP1 Antibody - BSA Free and earn rewards!

Have you used NCCRP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NCCRP1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Is the product NBP2-13642 reactive to fish NCCRP1, specifically carp?

    A:

    The immunogen of NCCRP1 antibody NBP2-13642 is less than 65% homologous to carp, so we would not recommend this antibody for your purposes. However, NCCRP1 antibody NB100-2071 may be suitable, as it has been validated in catfish.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...