NDUFB4 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03538

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all NDUFB4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NDUFB4 (NP_001161803.1). MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIENPALLRWAYARTINVYPNFRPTPKNSLMG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NDUFB4 Antibody - Azide and BSA Free

Western Blot: NDUFB4 AntibodyAzide and BSA Free [NBP3-03538]

Western Blot: NDUFB4 AntibodyAzide and BSA Free [NBP3-03538]

Western Blot: NDUFB4 Antibody [NBP3-03538] - Analysis of extracts of various cell lines, using NDUFB4 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.
Immunocytochemistry/ Immunofluorescence: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunocytochemistry/ Immunofluorescence: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunocytochemistry/Immunofluorescence: NDUFB4 Antibody [NBP3-03538] - Analysis of U-2 OS cells using NDUFB4 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunohistochemistry-Paraffin: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP3-03538] - Immunohistochemistry of paraffin-embedded rat kidney using [KO Validated] NDUFB4 Rabbit pAb (NBP3-03538) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunocytochemistry/ Immunofluorescence: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunocytochemistry/Immunofluorescence: NDUFB4 Antibody [NBP3-03538] - Analysis of L929 cells using NDUFB4 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunohistochemistry-Paraffin: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP3-03538] - Immunohistochemistry of paraffin-embedded human liver using [KO Validated] NDUFB4 Rabbit pAb (NBP3-03538) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunohistochemistry-Paraffin: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Immunohistochemistry-Paraffin: NDUFB4 Antibody [NBP3-03538] - Immunohistochemistry of paraffin-embedded mouse kidney using [KO Validated] NDUFB4 Rabbit pAb (NBP3-03538) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Knockout Validated: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Western Blot: NDUFB4 Antibody - Azide and BSA Free [NBP3-03538]

Western Blot: NDUFB4 Antibody [NBP3-03538] - Analysis of extracts from normal (control) and NDUFB4 knockout (KO) HeLa cells, using NDUFB4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Applications for NDUFB4 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFB4

The NDUFB4 gene encodes a non-catalytic subunit of the multisubunit NADH:ubiquinone oxidoreductase, the first enzyme complex in the mitochondrial electron transport chain (complex I). Mammalian complex I is composed of 45 different subunits and transfers electr

Alternate Names

B15, CI-B15, complex I B15 subunit, Complex I-B15, MGC5105, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4 (15kD, B15), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4, NADH-ubiquinone oxidoreductase B15 subunit

Gene Symbol

NDUFB4

Additional NDUFB4 Products

Product Documents for NDUFB4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NDUFB4 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for NDUFB4 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review NDUFB4 Antibody - Azide and BSA Free and earn rewards!

Have you used NDUFB4 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies