NDUFB8 Antibody (6T8G1)

Novus Biologicals | Catalog # NBP3-15882

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6T8G1 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NDUFB8 (O95169). MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVY

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NDUFB8 Antibody (6T8G1)

Western Blot: NDUFB8 Antibody (6T8G1) [NBP3-15882]

Western Blot: NDUFB8 Antibody (6T8G1) [NBP3-15882]

Western Blot: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Western blot analysis of extracts of various cell lines, using NDUFB8 Rabbit mAb (NBP3-15882) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: NDUFB8 Antibody (6T8G1) [NBP3-15882]

Western Blot: NDUFB8 Antibody (6T8G1) [NBP3-15882]

Western Blot: NDUFB8 Antibody (6T8G1) [NBP3-15882] - Western blot analysis of extracts of various cell lines, using NDUFB8 Rabbit mAb (NBP3-15882) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
NDUFB8 Antibody (6T8G1)

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] -

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NDUFB8 Antibody (6T8G1)

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] -

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human colon using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NDUFB8 Antibody (6T8G1)

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] -

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Rat liver using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NDUFB8 Antibody (6T8G1)

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] -

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NDUFB8 Antibody (6T8G1)

Immunocytochemistry/ Immunofluorescence: NDUFB8 Antibody (6T8G1) [NDUFB8] -

Immunocytochemistry/ Immunofluorescence: NDUFB8 Antibody (6T8G1) [NDUFB8] - Confocal imaging of paraffin-embedded Mouse brain using NDUFB8 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
NDUFB8 Antibody (6T8G1)

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] -

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NDUFB8 Antibody (6T8G1)

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] -

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Human kidney using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NDUFB8 Antibody (6T8G1)

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] -

Immunohistochemistry: NDUFB8 Antibody (6T8G1) [NDUFB8] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using NDUFB8 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for NDUFB8 Antibody (6T8G1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:1000 - 1:3000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFB8

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Alternate Names

CI-ASHImitochondrial, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19kD, ASHI), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa, NADH:ubiquinone oxidoreductase ASHI subunit, NADH-ubiquinone oxidoreductase ASHI subunit

Gene Symbol

NDUFB8

Additional NDUFB8 Products

Product Documents for NDUFB8 Antibody (6T8G1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDUFB8 Antibody (6T8G1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFB8 Antibody (6T8G1)

There are currently no reviews for this product. Be the first to review NDUFB8 Antibody (6T8G1) and earn rewards!

Have you used NDUFB8 Antibody (6T8G1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...