Ndufs1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35706

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 80-290 of human Ndufs1 (NP_004997.4).

Sequence:
VEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Ndufs1 Antibody - BSA Free

Ndufs1 Antibody

Immunocytochemistry/ Immunofluorescence: Ndufs1 Antibody [NBP3-35706] -

Immunocytochemistry/ Immunofluorescence: Ndufs1 Antibody [NBP3-35706] - Immunofluorescence analysis of HeLa cells using Ndufs1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Ndufs1 Antibody

Immunocytochemistry/ Immunofluorescence: Ndufs1 Antibody [NBP3-35706] -

Immunocytochemistry/ Immunofluorescence: Ndufs1 Antibody [NBP3-35706] - Immunofluorescence analysis of HepG2 cells using Ndufs1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Ndufs1 Antibody

Immunocytochemistry/ Immunofluorescence: Ndufs1 Antibody [NBP3-35706] -

Immunocytochemistry/ Immunofluorescence: Ndufs1 Antibody [NBP3-35706] - Immunofluorescence analysis of NIH/3T3 cells using Ndufs1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Ndufs1 Antibody

Western Blot: Ndufs1 Antibody [NBP3-35706] -

Western Blot: Ndufs1 Antibody [NBP3-35706] - Western blot analysis of various lysates using Ndufs1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
Ndufs1 Antibody

Immunohistochemistry: Ndufs1 Antibody [NBP3-35706] -

Immunohistochemistry: Ndufs1 Antibody [NBP3-35706] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Ndufs1 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Ndufs1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Ndufs1

Ndufs1 is encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency. [provided by RefSeq]

Long Name

NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

Alternate Names

CI-75kD, Complex I-75kD, EC 7.1.1.2

Gene Symbol

NDUFS1

Additional Ndufs1 Products

Product Documents for Ndufs1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ndufs1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ndufs1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ndufs1 Antibody - BSA Free and earn rewards!

Have you used Ndufs1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...