NDUFV1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38496

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 72-420 of human NDUFV1 (NP_009034.2).

Sequence:
GPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NDUFV1 Antibody - BSA Free

NDUFV1 Antibody

Immunohistochemistry: NDUFV1 Antibody [NBP3-38496] -

Immunohistochemistry: NDUFV1 Antibody [NBP3-38496] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using NDUFV1 Rabbit pAb at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NDUFV1 Antibody

Immunohistochemistry: NDUFV1 Antibody [NBP3-38496] -

Immunohistochemistry: NDUFV1 Antibody [NBP3-38496] - Immunohistochemistry analysis of paraffin-embedded Human liver using NDUFV1 Rabbit pAb at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NDUFV1 Antibody

Western Blot: NDUFV1 Antibody [NBP3-38496] -

Western Blot: NDUFV1 Antibody [NBP3-38496] - Western blot analysis of various lysates using NDUFV1 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
NDUFV1 Antibody

Immunohistochemistry: NDUFV1 Antibody [NBP3-38496] -

Immunohistochemistry: NDUFV1 Antibody [NBP3-38496] - Immunohistochemistry analysis of paraffin-embedded Rat brain using NDUFV1 Rabbit pAb at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
NDUFV1 Antibody

Western Blot: NDUFV1 Antibody [NBP3-38496] -

Western Blot: NDUFV1 Antibody [NBP3-38496] - Western blot analysis of various lysates using NDUFV1 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for NDUFV1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDUFV1

The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.[supplied by OMIM]

Alternate Names

CI-51K, CI51KD, CI-51kD, complex I 51kDa subunit, complex I, mitochondrial respiratory chain, Complex I-51kD, EC 1.6.5.3, EC 1.6.99.3, EC 1.6.99.5, FLJ59059, mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1, NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD), NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa, NADH dehydrogenase flavoprotein 1, NADH-ubiquinone oxidoreductase 51 kDa subunit, UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

Gene Symbol

NDUFV1

Additional NDUFV1 Products

Product Documents for NDUFV1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NDUFV1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NDUFV1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NDUFV1 Antibody - BSA Free and earn rewards!

Have you used NDUFV1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...