NF2/Merlin Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-03740
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse, Rat
Applications
Knockout Validated, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 477-576 of human NF2/Merlin (NP_000259.1). TKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNT
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for NF2/Merlin Antibody - BSA Free
Western Blot: NF2/Merlin Antibody - BSA Free [NF2/Merlin] -
Western Blot: NF2/Merlin Antibody - BSA Free [NF2/Merlin] - Western blot analysis of lysates from wild type (WT) and NF2/Merlin knockdown (KD) HeLa cells using [KD Validated] NF2/Merlin Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit
Exposure time: 180 s.
Immunoprecipitation: NF2/Merlin Antibody - BSA Free [NBP3-03740]
Immunoprecipitation: NF2/Merlin Antibody [NBP3-03740] - Immunoprecipitation analysis of 200ug extracts of SKOV3 cells using 3ug NF2/Merlin antibody (NBP3-03740). Western blot was performed from the immunoprecipitate using NF2/Merlin antibody (NBP3-03740) at a dilution of 1:1000.Western Blot: NF2/Merlin Antibody - BSA Free [NF2/Merlin] -
Western Blot: NF2/Merlin Antibody - BSA Free [NF2/Merlin] - Western blot analysis of various lysates using [KD Validated] NF2/Merlin Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit
Exposure time: 30 s.
Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody - BSA Free [NBP3-03740]
Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP3-03740] - Immunofluorescence analysis of C6 cells using NF2/Merlin antibody (NBP3-03740) at dilution of 1:100. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody - BSA Free [NF2/Merlin] -
Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody - BSA Free [NF2/Merlin] - Immunofluorescence analysis of U2OS cells using [KD Validated] NF2/Merlin Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody - BSA Free [NF2/Merlin] -
Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody - BSA Free [NF2/Merlin] - Immunofluorescence analysis of L929 cells using [KD Validated] NF2/Merlin Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.Applications for NF2/Merlin Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunoprecipitation
1:500 - 1:1000
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: NF2/Merlin
Long Name
Neurofibromin 2
Alternate Names
ACN, BANF, Merlin, SCH, Schwannomerlin, Schwannomin
Gene Symbol
NF2
Additional NF2/Merlin Products
Product Documents for NF2/Merlin Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for NF2/Merlin Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for NF2/Merlin Antibody - BSA Free
There are currently no reviews for this product. Be the first to review NF2/Merlin Antibody - BSA Free and earn rewards!
Have you used NF2/Merlin Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...