NF2/Merlin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03740

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NF2/Merlin Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 477-576 of human NF2/Merlin (NP_000259.1). TKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NF2/Merlin Antibody - BSA Free

NF2/Merlin Antibody - BSA Free

Western Blot: NF2/Merlin Antibody - BSA Free [NF2/Merlin] -

Western Blot: NF2/Merlin Antibody - BSA Free [NF2/Merlin] - Western blot analysis of lysates from wild type (WT) and NF2/Merlin knockdown (KD) HeLa cells using [KD Validated] NF2/Merlin Rabbit pAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit
Exposure time: 180 s.
Immunoprecipitation: NF2/Merlin Antibody - BSA Free [NBP3-03740]

Immunoprecipitation: NF2/Merlin Antibody - BSA Free [NBP3-03740]

Immunoprecipitation: NF2/Merlin Antibody [NBP3-03740] - Immunoprecipitation analysis of 200ug extracts of SKOV3 cells using 3ug NF2/Merlin antibody (NBP3-03740). Western blot was performed from the immunoprecipitate using NF2/Merlin antibody (NBP3-03740) at a dilution of 1:1000.
NF2/Merlin Antibody - BSA Free

Western Blot: NF2/Merlin Antibody - BSA Free [NF2/Merlin] -

Western Blot: NF2/Merlin Antibody - BSA Free [NF2/Merlin] - Western blot analysis of various lysates using [KD Validated] NF2/Merlin Rabbit pAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit
Exposure time: 30 s.
Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody - BSA Free [NBP3-03740]

Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody - BSA Free [NBP3-03740]

Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP3-03740] - Immunofluorescence analysis of C6 cells using NF2/Merlin antibody (NBP3-03740) at dilution of 1:100. Blue: DAPI for nuclear staining.
NF2/Merlin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody - BSA Free [NF2/Merlin] -

Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody - BSA Free [NF2/Merlin] - Immunofluorescence analysis of U2OS cells using [KD Validated] NF2/Merlin Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
NF2/Merlin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody - BSA Free [NF2/Merlin] -

Immunocytochemistry/ Immunofluorescence: NF2/Merlin Antibody - BSA Free [NF2/Merlin] - Immunofluorescence analysis of L929 cells using [KD Validated] NF2/Merlin Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for NF2/Merlin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NF2/Merlin

Merlin, also known as Neurofibromin 2 (NF2), is a tumor suppressor gene. Merlin is closely related to the ERM (ezrin, radixin, moesin) family of proteins. The precise function of Merlin is not clear. It is thought to provide a link between the actin cytoskeleten and membrane associated proteins, playing a role in transduction of extracellular signals. Merlin has been implicated in cell proliferation and cellular motility.

Long Name

Neurofibromin 2

Alternate Names

ACN, BANF, Merlin, SCH, Schwannomerlin, Schwannomin

Gene Symbol

NF2

Additional NF2/Merlin Products

Product Documents for NF2/Merlin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NF2/Merlin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Stem Cell Markers

Customer Reviews for NF2/Merlin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NF2/Merlin Antibody - BSA Free and earn rewards!

Have you used NF2/Merlin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies