Nicotinic Acetylcholine Receptor beta 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82288

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Nicotinic Acetylcholine Receptor beta 2. Peptide sequence: CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Nicotinic Acetylcholine Receptor beta 2 Antibody - BSA Free

Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82288]

Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82288]

Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82288] - WB Suggested Anti-CHRNB2 Antibody Titration: 2.5ug/ml. Positive Control: Jurkat cell lysateCHRNB2 is supported by BioGPS gene expression data to be expressed in Jurkat
Immunohistochemistry: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82288]

Immunohistochemistry: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82288]

Immunohistochemistry: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP2-82288] - Human kidney

Applications for Nicotinic Acetylcholine Receptor beta 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R beta 2/CHRNB2

The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits. After binding Acetylcholine, the Nicotinic Acetylcholine Receptor (AChR) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Neuronal AChR seems to be composed of two different type of subunits: alpha and beta.

Long Name

Nicotinic Acetylcholine Receptor beta 2

Alternate Names

Cholinergic Receptor Nicotinic Beta 2 Subunit, CHRNB2, EFNL3, NAChRB2, Neuronal Nicotinic Acetylcholine R beta 2

Gene Symbol

CHRNB2

Additional Nicotinic Acetylcholine R beta 2/CHRNB2 Products

Product Documents for Nicotinic Acetylcholine Receptor beta 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine Receptor beta 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nicotinic Acetylcholine Receptor beta 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nicotinic Acetylcholine Receptor beta 2 Antibody - BSA Free and earn rewards!

Have you used Nicotinic Acetylcholine Receptor beta 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Nicotinic Acetylcholine Receptor beta 2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

    A:

    A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...