NMDARA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92187

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NMDARA1 Antibody - BSA Free

Western Blot: NMDARA1 Antibody [NBP1-92187]

Western Blot: NMDARA1 Antibody [NBP1-92187]

Western Blot: NMDARA1 Antibody [NBP1-92187] - Analysis in control (vector only transfected HEK293T lysate) and GRINA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: NMDARA1 Antibody [NBP1-92187]

Immunocytochemistry/ Immunofluorescence: NMDARA1 Antibody [NBP1-92187]

Immunocytochemistry/Immunofluorescence: NMDARA1 Antibody [NBP1-92187] - Staining of human cell line MCF7 shows localization to nucleoli fibrillar center.
Immunohistochemistry-Paraffin: NMDARA1 Antibody [NBP1-92187]

Immunohistochemistry-Paraffin: NMDARA1 Antibody [NBP1-92187]

Immunohistochemistry-Paraffin: NMDARA1 Antibody [NBP1-92187] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.
NMDARA1 Antibody - BSA Free Western Blot: NMDARA1 Antibody - BSA Free [NBP1-92187]

Western Blot: NMDARA1 Antibody - BSA Free [NBP1-92187]

Analysis in control (vector only transfected HEK293T lysate) and GRINA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
NMDARA1 Antibody - BSA Free Immunohistochemistry: NMDARA1 Antibody - BSA Free [NBP1-92187]

Immunohistochemistry: NMDARA1 Antibody - BSA Free [NBP1-92187]

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
NMDARA1 Antibody - BSA Free Immunohistochemistry: NMDARA1 Antibody - BSA Free [NBP1-92187]

Immunohistochemistry: NMDARA1 Antibody - BSA Free [NBP1-92187]

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
NMDARA1 Antibody - BSA Free Immunohistochemistry: NMDARA1 Antibody - BSA Free [NBP1-92187]

Immunohistochemistry: NMDARA1 Antibody - BSA Free [NBP1-92187]

Staining of the human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
NMDARA1 Antibody - BSA Free Immunohistochemistry: NMDARA1 Antibody - BSA Free [NBP1-92187]

Immunohistochemistry: NMDARA1 Antibody - BSA Free [NBP1-92187]

Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Applications for NMDARA1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NMDARA1

Alternate Names

glutamate [NMDA] receptor-associated protein 1, glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1(glutamate binding), glutamate receptor, NMDA subtype, glutamate-binding subunit, HNRGW, LFG1, NMDA receptor glutamate-binding subunit, NMDARA1MGC99687, Putative MAPK-activating protein PM02, TMBIM3, transmembrane BAX inhibitor motif containing 3

Gene Symbol

GRINA

Additional NMDARA1 Products

Product Documents for NMDARA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NMDARA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NMDARA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NMDARA1 Antibody - BSA Free and earn rewards!

Have you used NMDARA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...