NMT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82547

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all NMT1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NMT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547]

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547]

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding NMT1 RNA-seq data are presented for the same tissues.
Western Blot: NMT1 Antibody [NBP1-82547]

Western Blot: NMT1 Antibody [NBP1-82547]

Western Blot: NMT1 Antibody [NBP1-82547] - Analysis using Anti-NMT1 antibody NBP1-82547 (A) shows similar pattern to independent antibody NBP1-82548 (B).
Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547]

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547]

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells.
Western Blot: NMT1 Antibody [NBP1-82547]

Western Blot: NMT1 Antibody [NBP1-82547]

Western Blot: NMT1 Antibody [NBP1-82547] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: NMT1 Antibody [NBP1-82547]

Western Blot: NMT1 Antibody [NBP1-82547]

Western Blot: NMT1 Antibody [NBP1-82547] - Analysis in human cell line HDLM-2.
Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547]

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547]

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells and basket cells.
Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547]

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547]

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547]

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547]

Immunohistochemistry-Paraffin: NMT1 Antibody [NBP1-82547] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Applications for NMT1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: NMT1

Myristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase (NMT; EC 2.3.1.97) catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the signal-transducing guanine nucleotide-binding protein (G protein) GO (GNAO1; MIM 139311) (Duronio et al., 1992 (PubMed 1570339)).(supplied by OMIM)

Alternate Names

alternative, short form NMT-S, glycylpeptide N-tetradecanoyltransferase 1, long form, NMT-L, Myristoyl-CoA:protein N-myristoyltransferase 1, NMT 1, NMTEC 2.3.1.97, N-myristoyltransferase 1, Peptide N-myristoyltransferase 1, Type I N-myristoyltransferase

Gene Symbol

NMT1

Additional NMT1 Products

Product Documents for NMT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for NMT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for NMT1 Antibody - BSA Free

Customer Reviews for NMT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NMT1 Antibody - BSA Free and earn rewards!

Have you used NMT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies