NOB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35775

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human NOB1 (NP_054781.1).

Sequence:
MAPVEHVVADAGAFLRHAALQDIGKNIYTIREVVTEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDIQVLALTYQLEAEFVGVSHLKQEPQKVKVSSSIQHPETPLHISGFHLPYKPKPPQETEKGHSACEPENLEFSSFMFWRNPLPNIDHELQELLIDRGEDVPSEEEEEEENGFEDRKDDSDDDGGGWITPSNIKQIQQELEQCDVPEDV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for NOB1 Antibody - BSA Free

NOB1 Antibody

Western Blot: NOB1 Antibody [NBP3-35775] -

Western Blot: NOB1 Antibody [NBP3-35775] - Western blot analysis of various lysates using NOB1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
NOB1 Antibody

Immunocytochemistry/ Immunofluorescence: NOB1 Antibody [NBP3-35775] -

Immunocytochemistry/ Immunofluorescence: NOB1 Antibody [NBP3-35775] - Immunofluorescence analysis of U-2 OS cells using NOB1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NOB1 Antibody

Immunocytochemistry/ Immunofluorescence: NOB1 Antibody [NBP3-35775] -

Immunocytochemistry/ Immunofluorescence: NOB1 Antibody [NBP3-35775] - Immunofluorescence analysis of C6 cells using NOB1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
NOB1 Antibody

Immunocytochemistry/ Immunofluorescence: NOB1 Antibody [NBP3-35775] -

Immunocytochemistry/ Immunofluorescence: NOB1 Antibody [NBP3-35775] - Immunofluorescence analysis of L929 cells using NOB1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for NOB1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NOB1

NOB1 may play a role in mRNA degradation

Alternate Names

adenocarcinoma antigen recognized by T lymphocytes 4, ART4, ART-4, MST158, nin one binding protein, NIN1/RPN12 binding protein 1 homolog (S. cerevisiae), NOB1PPSMD8BP1, Phosphorylation regulatory protein HP-10, Protein ART-4, PSMD8 binding protein 1, RNA-binding protein NOB1

Gene Symbol

NOB1

Additional NOB1 Products

Product Documents for NOB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NOB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NOB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review NOB1 Antibody - BSA Free and earn rewards!

Have you used NOB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...