NONO Antibody (0V0N8)

Novus Biologicals | Catalog # NBP3-16276

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0V0N8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 372-471 of human NONO (Q15233). GTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for NONO Antibody (0V0N8)

Western Blot: NONO Antibody (0V0N8) [NBP3-16276]

Western Blot: NONO Antibody (0V0N8) [NBP3-16276]

Western Blot: NONO Antibody (0V0N8) [NBP3-16276] - Western blot analysis of extracts of various cell lines, using NONO Rabbit mAb (NBP3-16276) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: NONO Antibody (0V0N8) [NBP3-16276]

Immunocytochemistry/ Immunofluorescence: NONO Antibody (0V0N8) [NBP3-16276]

Immunocytochemistry/Immunofluorescence: NONO Antibody (0V0N8) [NBP3-16276] - Immunofluorescence analysis of U-2 OS cells using NONO Rabbit mAb (NBP3-16276) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: NONO Antibody (0V0N8) [NBP3-16276]

Western Blot: NONO Antibody (0V0N8) [NBP3-16276]

Western Blot: NONO Antibody (0V0N8) [NBP3-16276] - Western blot analysis of extracts of Rat liver, using NONO Rabbit mAb (NBP3-16276) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: NONO Antibody (0V0N8) [NBP3-16276]

Immunocytochemistry/ Immunofluorescence: NONO Antibody (0V0N8) [NBP3-16276]

Immunocytochemistry/Immunofluorescence: NONO Antibody (0V0N8) [NBP3-16276] - Immunofluorescence analysis of C6 cells using NONO Rabbit mAb (NBP3-16276) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: NONO Antibody (0V0N8) [NBP3-16276]

Immunocytochemistry/ Immunofluorescence: NONO Antibody (0V0N8) [NBP3-16276]

Immunocytochemistry/Immunofluorescence: NONO Antibody (0V0N8) [NBP3-16276] - Immunofluorescence analysis of NIH-3T3 cells using NONO Rabbit mAb (NBP3-16276) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: NONO Antibody (0V0N8) [NBP3-16276]

Immunohistochemistry-Paraffin: NONO Antibody (0V0N8) [NBP3-16276]

Immunohistochemistry-Paraffin: NONO Antibody (0V0N8) [NBP3-16276] - Immunohistochemistry of paraffin-embedded human esophageal cancer using NONO Rabbit mAb (NBP3-16276) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
NONO Antibody (0V0N8)

Immunohistochemistry: NONO Antibody (0V0N8) [NBP3-16276] -

Immunohistochemistry: NONO Antibody (0V0N8) [NBP3-16276] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using NONO Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
NONO Antibody (0V0N8)

Immunohistochemistry: NONO Antibody (0V0N8) [NBP3-16276] -

Immunohistochemistry: NONO Antibody (0V0N8) [NBP3-16276] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using NONO Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
NONO Antibody (0V0N8)

Immunohistochemistry: NONO Antibody (0V0N8) [NBP3-16276] -

Immunohistochemistry: NONO Antibody (0V0N8) [NBP3-16276] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using NONO Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
NONO Antibody (0V0N8)

Immunohistochemistry: NONO Antibody (0V0N8) [NBP3-16276] -

Immunohistochemistry: NONO Antibody (0V0N8) [NBP3-16276] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using NONO Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
NONO Antibody (0V0N8)

Immunohistochemistry: NONO Antibody (0V0N8) [NBP3-16276] -

Immunohistochemistry: NONO Antibody (0V0N8) [NBP3-16276] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using NONO Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
NONO Antibody (0V0N8)

Immunohistochemistry: NONO Antibody (0V0N8) [NBP3-16276] -

Immunohistochemistry: NONO Antibody (0V0N8) [NBP3-16276] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using NONO Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for NONO Antibody (0V0N8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NONO

Non-POU-domain-containing octamer binding protein (NONO) is a member of the DBHS (drosophila behavior, human splicing) domain-containing family and is an RNA- and DNA- binding protein. NONO and other DBHS domain-containing proteins are multifunctional and are reported to be involved in transcriptional regulation, mRNA processing, and DNA non-homologous end joining (NHEJ). NONO functions as a coregulator of the androgen receptor (AR) and also regulates cAMP transcriptional activity by interacting with gene promoter elements. NONO is also involved in pre-mRNA splicing through an interaction with U5 snRNA and can stimulate DNA nonhomologous end joining (NHEJ) through the interaction with ku70/G22p and ku80/XRCC5 dimers. Alternate names for NONO include 54 kDa nuclear RNA- and DNA-binding protein, p54 (nrb), 55 kDa nuclear protein, NMT55, DNA-binding p52/p100 complex, NRB54, P54, and P54NRB.

Alternate Names

NMT5552 kDa subunit, non-POU domain containing, octamer-binding, NRB54non-POU-domain-containing, octamer-binding, p54(nrb)

Gene Symbol

NONO

Additional NONO Products

Product Documents for NONO Antibody (0V0N8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for NONO Antibody (0V0N8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for NONO Antibody (0V0N8)

There are currently no reviews for this product. Be the first to review NONO Antibody (0V0N8) and earn rewards!

Have you used NONO Antibody (0V0N8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...